BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060157.seq (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-tran... 28 0.31 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 25 2.2 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 25 2.9 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 24 5.0 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 8.8 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 8.8 AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. 23 8.8 >AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-transferase u2 protein. Length = 222 Score = 27.9 bits (59), Expect = 0.31 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +1 Query: 136 ISDNFQEKRRKPISRTPHYTRRRDVGDAETATLLPLRLAPMPWAMLH 276 ISD + +K ++ HY R D E T+ L L P + +H Sbjct: 126 ISDEMKTTTQKALTDLEHYLTRNDYFAGENLTIADLSLVPTIASAVH 172 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.0 bits (52), Expect = 2.2 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 343 LETARQLKRAHGFQEGRGPSHAKGAHRTPLEAHQNGAE 456 L A + ++ Q GR PS A A T +H N A+ Sbjct: 6 LTVAGMMVKSEASQTGRSPSAAGTATTTTSPSHSNAAK 43 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 544 PALAVGRGW 518 PALA GRGW Sbjct: 547 PALATGRGW 555 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 24.6 bits (51), Expect = 2.9 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +1 Query: 445 NGAETTRGQPAPPAHHT 495 +G ++TRG PAP + H+ Sbjct: 25 SGLDSTRGSPAPGSRHS 41 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.8 bits (49), Expect = 5.0 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +1 Query: 370 AHGFQEGRGPSHAKGAHRTPLEAHQNGAETTRGQPAPP 483 A G Q RGP KG + + G + GQ PP Sbjct: 228 APGIQGVRGPQGVKGEPGEKGDRGEIGVKGLMGQSGPP 265 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 393 WSVACKRSTPYALRSPSKWSRNNKRTTCTS 482 WS + +R P+ S KW+ NN + + TS Sbjct: 1648 WS-SIRRPGPFG--SKQKWNSNNNKMSATS 1674 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/34 (29%), Positives = 13/34 (38%) Frame = +1 Query: 388 GRGPSHAKGAHRTPLEAHQNGAETTRGQPAPPAH 489 G H H P + Q + + R P PP H Sbjct: 179 GHSQHHHHHHHHHPHHSQQQHSASPRCYPMPPEH 212 >AJ130949-1|CAA10258.1| 401|Anopheles gambiae SG1 protein protein. Length = 401 Score = 23.0 bits (47), Expect = 8.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 170 RSLALRTTPGGEMSVMQKRQHCYLCDLPP 256 RSL L + GG K H YL PP Sbjct: 140 RSLVLMSVQGGASKQALKYYHYYLEGQPP 168 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,793 Number of Sequences: 2352 Number of extensions: 13362 Number of successful extensions: 33 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -