BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060155.seq (692 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1469 - 26742772-26743848 29 3.5 01_06_1415 + 37171380-37171923,37172476-37172666,37173628-37173678 29 3.5 03_05_0882 + 28467691-28467730,28468386-28468675,28469262-284694... 29 4.6 05_07_0328 + 29286109-29286120,29286982-29287146,29288427-292885... 28 6.1 04_01_0203 + 2432745-2433642,2433723-2433806,2434458-2434471 28 6.1 07_03_0508 - 18892193-18893119,18893183-18894528,18894594-18895206 28 8.1 >07_03_1469 - 26742772-26743848 Length = 358 Score = 29.1 bits (62), Expect = 3.5 Identities = 27/79 (34%), Positives = 30/79 (37%), Gaps = 1/79 (1%) Frame = +2 Query: 458 DFVFIFDHTEKMGXKMATDRHRRLQATTQQFQRAKKXRLAGAXPRQXWRX*RELRNSRLA 637 D F E G + R AT Q AK RLAG P Q + E S LA Sbjct: 183 DLASCFLAGESAGGNIVHQVANRWAATWQP--TAKNLRLAGMIPVQPYFGGEERTPSELA 240 Query: 638 LXGVYSLXN-RAXPLPWXA 691 L GV + N R W A Sbjct: 241 LDGVAPVVNLRRSDFSWKA 259 >01_06_1415 + 37171380-37171923,37172476-37172666,37173628-37173678 Length = 261 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 332 KKKVINNNKYILFNSWYTKIKQPEWPSSPAMWDLVKNTPELADFV 466 + I+ N Y+ +W T+ QP S W L K + A +V Sbjct: 133 RSSTISENSYLCVATWDTRAPQPSQIESAVRWALRKRSQNKAVYV 177 >03_05_0882 + 28467691-28467730,28468386-28468675,28469262-28469411, 28470126-28470214,28470331-28470440,28470545-28470639, 28471110-28471162,28471374-28471539,28471909-28472001, 28472304-28472432,28472549-28472668,28472862-28472942, 28473495-28473602,28473895-28474038,28474120-28474218, 28474300-28474379,28474830-28474922,28475197-28475320 Length = 687 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +3 Query: 111 QKSNMVNMPEQQSSTETAAVCKNEKLLNKLESSSY-NKSNMDQLIAIVNSW 260 +KSN++ E++ + TA + +KL+ KLE S+ D+ +++N W Sbjct: 410 EKSNLLEEAEKKIAELTAKAEEQQKLILKLEDDILKGYSSTDRRTSLLNDW 460 >05_07_0328 + 29286109-29286120,29286982-29287146,29288427-29288589, 29288625-29288903,29289047-29289122,29289725-29289787, 29292116-29292164,29292413-29292504,29293017-29293068, 29293209-29293271,29293382-29293431,29293941-29294016, 29294444-29294656,29294763-29294869,29294966-29295074, 29295489-29295689,29295773-29296033,29296154-29296171, 29296287-29296397,29296755-29297030,29297108-29297382, 29297814-29298165,29298371-29298655,29298715-29299261, 29301658-29301781,29301871-29301946,29302062-29302136, 29302300-29302353,29302833-29302892,29302977-29303093, 29303228-29303361,29303480-29303682,29303879-29303976, 29304358-29304461,29304537-29304702,29304803-29304925, 29305047-29305129,29305217-29305358,29305523-29305549, 29305784-29305854,29305930-29306518 Length = 2046 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 212 LQQIQHGPANCYCKFLEKKNINYILNVMPVMQDERKMSK 328 L Q +HG + C F + N+ Y + V+ +E + SK Sbjct: 983 LDQYEHGCSIISCSFSDDNNVYYCVGTAYVLPEENEPSK 1021 >04_01_0203 + 2432745-2433642,2433723-2433806,2434458-2434471 Length = 331 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 380 YTKIKQPEWPSSPAMWDLVKNTPELADFVFI-FDHTEK 490 + + +PEWPSS A+ N PEL V + D T K Sbjct: 169 HDQTNKPEWPSSVAVQHDQTNKPELPSSVAVQHDQTNK 206 >07_03_0508 - 18892193-18893119,18893183-18894528,18894594-18895206 Length = 961 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +2 Query: 20 RCVFITNELPGCWALKKYIIKNTSGSFQRFTKIKHGKHAGATI 148 + FIT C+ + +KN +FQR T+I G G + Sbjct: 803 KTAFITRIGTYCYTTMPFGLKNAGPTFQRTTRISLGSQIGRNV 845 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,105,851 Number of Sequences: 37544 Number of extensions: 364435 Number of successful extensions: 870 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 870 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -