BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060154.seq (527 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 4.5 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 5.9 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 7.8 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 7.8 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 7.8 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.8 bits (44), Expect = 4.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 311 SSSLIASLAFRFIVVNFSTCHPIDYRSLY 225 + SLIA+ AF F + F T +LY Sbjct: 290 TDSLIAAQAFVFFLAGFETSSTTMSNALY 318 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 5.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 85 HRFDLIHFENDIRLSGLMIA 26 HR F+ND+R S L +A Sbjct: 225 HRLTSKTFDNDLRYSELAVA 244 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +2 Query: 29 NHQPAQTNIVFKMNEIKS 82 +H P QT + FK+++ K+ Sbjct: 343 DHAPKQTEVRFKVHDPKA 360 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +2 Query: 29 NHQPAQTNIVFKMNEIKS 82 +H P QT + FK+++ K+ Sbjct: 343 DHAPKQTEVRFKVHDPKA 360 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 7.8 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = -2 Query: 268 STSRPATQ*TIDLCICDGLVLDRFHFCGGTANLTRLNIEDALSTAVLL 125 + ++P T+ + + + D HFC + N E AL TA+++ Sbjct: 437 ANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKVNNAEYALLTAIVI 484 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,433 Number of Sequences: 438 Number of extensions: 2297 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14845611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -