BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060150.seq (678 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0194 + 13645418-13645790,13645879-13647653 30 2.0 03_06_0246 + 32622793-32622804,32622883-32623057,32623395-326236... 29 4.5 >01_03_0194 + 13645418-13645790,13645879-13647653 Length = 715 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +2 Query: 458 EFFERSTIRSSRGATSPILTRGVEEGRSLLDGVSGPLVATNSLAHELSQM 607 EF + S + ++ ++ +GV+ G+ L+DG+ N LA S+M Sbjct: 620 EFDRMMQLLSEKSKSNEVVCKGVQLGKQLVDGIQNENKGWNMLAEFWSEM 669 >03_06_0246 + 32622793-32622804,32622883-32623057,32623395-32623659, 32624594-32624693,32625076-32625125,32625239-32625293, 32625742-32625774 Length = 229 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -2 Query: 653 NVWLFF*SFLQLVVGSSARVHGPASWLRPADRSPRPADC 537 NVWL L LVV S+ + +WLRPA+ PA C Sbjct: 11 NVWLDVPLVLLLVVQSALK-----AWLRPAEFESSPAPC 44 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,975,689 Number of Sequences: 37544 Number of extensions: 297435 Number of successful extensions: 900 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 900 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -