BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060149.seq (680 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 25 0.67 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 24 1.5 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 8.2 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 25.0 bits (52), Expect = 0.67 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +3 Query: 198 SLSRQNCAECSYHGSRVLQDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 353 SL R+ + + VL+ Q +A K A + N II+EPT YG Sbjct: 332 SLRRKRQKINNSQNALVLRHVQAEAEKHAAMLYQYNFNIIISEPTERISPYG 383 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 507 IVQSPHXPSGCRRRWISXRRYHP 439 I + H P+G + WI+ RY P Sbjct: 789 IQKQSHTPNGIVKTWIAHDRYLP 811 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 8.2 Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +3 Query: 246 VLQDSQRQATKDAGTI-SGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDV 422 V+Q+ K A + + LN+ I P+ Y + + N+L DL G ++ Sbjct: 768 VVQEISSDGLKFAFDVKTTLNISDIALYPSQTTHGYDIYASSIDKENILFLDLSTGKVEM 827 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,344 Number of Sequences: 438 Number of extensions: 3654 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -