BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060145.seq (677 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 39 4e-05 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 38.7 bits (86), Expect = 4e-05 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = +3 Query: 360 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 EV V+G + PI FE + ++ + VK GY +PT IQ P+ +S R Sbjct: 145 EVKVTGNDAPPPITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGR 196 Score = 35.5 bits (78), Expect = 4e-04 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +2 Query: 446 KDNGLQRTDAYSSSRLADSYVGKNLVGVAQTGSGKTLAYILPAIVHI--NNQPP 601 K +G + A + G++L+ AQTGSGKT A++LP I ++ + PP Sbjct: 174 KKSGYTKPTAIQKYAIPVILSGRDLMSCAQTGSGKTAAFMLPIIHNLLSDKNPP 227 Score = 25.4 bits (53), Expect = 0.43 Identities = 9/16 (56%), Positives = 14/16 (87%) Frame = +1 Query: 622 PIALVLAPTRELAQQI 669 P+ ++++PTRELA QI Sbjct: 236 PVVVIMSPTRELAIQI 251 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,819 Number of Sequences: 336 Number of extensions: 3282 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -