BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060145.seq (677 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 61 9e-10 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 54 1e-07 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 50 1e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 47 1e-05 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 44 1e-04 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 39 0.003 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.023 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 36 0.040 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 35 0.070 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 34 0.092 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 33 0.16 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 33 0.21 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 33 0.28 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 31 0.86 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 31 1.1 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 30 2.0 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 30 2.0 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 29 3.5 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 29 3.5 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 29 4.6 SB_25016| Best HMM Match : PDZ (HMM E-Value=5.6e-08) 28 6.0 SB_22560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_19645| Best HMM Match : Smr (HMM E-Value=8.2) 28 8.0 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 8.0 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 70.9 bits (166), Expect = 9e-13 Identities = 31/89 (34%), Positives = 47/89 (52%) Frame = +3 Query: 249 PRWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPD 428 P + +PFNKNFY+ HP + K+S E+++ R + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 429 YVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 + ++ + Y +PT IQ Q PIA+S R Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGR 555 Score = 53.6 bits (123), Expect = 1e-07 Identities = 21/41 (51%), Positives = 34/41 (82%) Frame = +2 Query: 509 GKNLVGVAQTGSGKTLAYILPAIVHINNQPPIRRGDGSRLL 631 G++++G+A+TGSGKT A++ PA+VHI +QP ++ GDG +L Sbjct: 554 GRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVL 594 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 622 PIALVLAPTRELAQQI 669 PI L+ APTREL QQI Sbjct: 591 PIVLICAPTRELCQQI 606 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 60.9 bits (141), Expect = 9e-10 Identities = 27/56 (48%), Positives = 37/56 (66%) Frame = +3 Query: 321 RSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 488 R +EV+ YR + ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = +2 Query: 560 YILPAIVHINNQPPIRRGDGSRLL 631 +ILP IVHIN+QP ++ GDG +L Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVL 136 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 622 PIALVLAPTRELAQQIQQ 675 PI LVL PTRELAQQ+Q+ Sbjct: 133 PIVLVLCPTRELAQQVQE 150 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 56.8 bits (131), Expect = 2e-08 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 1/86 (1%) Frame = +3 Query: 261 SVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHE-VTVSGVEVHNPIQYFEEANFPDYVQ 437 +V QPF K+FY P + K +P E +E+R + E + V G P++ + + + Sbjct: 58 TVVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKIL 117 Query: 438 QGVKTMGYKEPTPIQAQGWPIAMSER 515 +K Y++PTPIQAQ P+ MS R Sbjct: 118 DVLKKNSYEKPTPIQAQAIPVIMSGR 143 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 53.6 bits (123), Expect = 1e-07 Identities = 24/74 (32%), Positives = 40/74 (54%) Frame = +3 Query: 294 YDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 473 Y HPT+ + +V++ R+ E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 474 PIQAQGWPIAMSER 515 PIQ Q P+ +S R Sbjct: 221 PIQMQVLPVLLSGR 234 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 50.4 bits (115), Expect = 1e-06 Identities = 21/57 (36%), Positives = 34/57 (59%) Frame = +3 Query: 345 YRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 +R + ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + R Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNR 139 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/33 (48%), Positives = 24/33 (72%) Frame = +2 Query: 512 KNLVGVAQTGSGKTLAYILPAIVHINNQPPIRR 610 ++++GVA+TGSGKT A+ +P +V I P I R Sbjct: 139 RDIIGVAETGSGKTAAFAIPLLVWIMGLPKIER 171 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = +1 Query: 622 PIALVLAPTRELAQQIQQ 675 P AL+LAPTRELAQQI++ Sbjct: 179 PYALILAPTRELAQQIEE 196 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 4/60 (6%) Frame = +3 Query: 333 EVEEYRNNHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 500 ++ +R+ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/79 (29%), Positives = 38/79 (48%) Frame = +3 Query: 279 FNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 458 F ++YD + V + S V+E R + + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 459 YKEPTPIQAQGWPIAMSER 515 ++ PTPIQ Q MS R Sbjct: 92 FQVPTPIQMQSLSCVMSGR 110 Score = 42.3 bits (95), Expect = 3e-04 Identities = 17/36 (47%), Positives = 26/36 (72%) Frame = +2 Query: 509 GKNLVGVAQTGSGKTLAYILPAIVHINNQPPIRRGD 616 G++++G+A+TGSGKTLAY LP + + + P GD Sbjct: 109 GRDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGD 144 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +1 Query: 622 PIALVLAPTRELAQQI 669 P+AL+L PTREL QQ+ Sbjct: 146 PVALILTPTRELMQQV 161 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = +2 Query: 446 KDNGLQRTDAYSSSRLADSYVGKNLVGVAQTGSGKTLAYILPAI 577 KD G +A G++L+G A+TGSGKTLA+++P + Sbjct: 588 KDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPVV 631 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/52 (40%), Positives = 27/52 (51%) Frame = +3 Query: 360 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 EV VSG I FEEAN + V+ YK+PTP+Q PI ++ R Sbjct: 698 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 749 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 509 GKNLVGVAQTGSGKTLAYILPAIVHINN 592 G++++ AQTGSGKT A++LP + + N Sbjct: 748 GRDVMACAQTGSGKTAAFLLPVMTSMMN 775 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/52 (40%), Positives = 27/52 (51%) Frame = +3 Query: 360 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 EV VSG I FEEAN + V+ YK+PTP+Q PI ++ R Sbjct: 121 EVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 172 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +2 Query: 455 GLQRTDAYSSSRLADSYVGKNLVGVAQTGSGKTLAYILPAIVHINNQ 595 G +R + L G++L+ AQTGSGKT AY+LP + + Q Sbjct: 498 GYRRPTPVQKAALPIVMAGRDLMACAQTGSGKTAAYMLPVLTSLIKQ 544 Score = 35.5 bits (78), Expect = 0.040 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +3 Query: 369 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 VSG I F E F + + + GY+ PTP+Q PI M+ R Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGR 517 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +1 Query: 622 PIALVLAPTRELAQQI 669 P+AL +APTRELA+QI Sbjct: 553 PLALCVAPTRELAKQI 568 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 36.3 bits (80), Expect = 0.023 Identities = 14/25 (56%), Positives = 21/25 (84%) Frame = +2 Query: 512 KNLVGVAQTGSGKTLAYILPAIVHI 586 ++++G A+TGSGKTLA+ +P I HI Sbjct: 169 RDIIGAAETGSGKTLAFGIPIIQHI 193 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 35.5 bits (78), Expect = 0.040 Identities = 13/23 (56%), Positives = 21/23 (91%) Frame = +2 Query: 509 GKNLVGVAQTGSGKTLAYILPAI 577 G++++G A+TGSGKTLA+++P I Sbjct: 87 GRDVLGAAKTGSGKTLAFLIPII 109 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 34.7 bits (76), Expect = 0.070 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +2 Query: 446 KDNGLQRTDAYSSSRLADSYVGKNLVGVAQTGSGKTLAYILPAI 577 +D G+ +S Y G++++G A+TG+GKTL++ LP + Sbjct: 89 EDRGITYLFPIQASTFNYIYDGEDVIGQARTGTGKTLSFALPLV 132 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 34.3 bits (75), Expect = 0.092 Identities = 15/54 (27%), Positives = 30/54 (55%) Frame = +2 Query: 437 TRCKDNGLQRTDAYSSSRLADSYVGKNLVGVAQTGSGKTLAYILPAIVHINNQP 598 ++C G+++ + + G++ +G A+TGSGKT A+ LP + + + P Sbjct: 20 SQCVAMGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGKTAAFALPILQKLCDDP 73 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 33.5 bits (73), Expect = 0.16 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +2 Query: 515 NLVGVAQTGSGKTLAYILPAIVHINNQPPIRRGDGSRL 628 +++ AQTGSGKTLAY+ P +VH + R G +RL Sbjct: 417 HVICAAQTGSGKTLAYLAP-LVHRLREDEERHGILARL 453 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 33.1 bits (72), Expect = 0.21 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +2 Query: 509 GKNLVGVAQTGSGKTLAYILPAIVH 583 G+++ GVA GSGK LAY+LP I+H Sbjct: 224 GRDVAGVAIEGSGKRLAYLLP-IIH 247 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 32.7 bits (71), Expect = 0.28 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = +2 Query: 512 KNLVGVAQTGSGKTLAYILPAIVHINNQP 598 K+++G+A+TGSGKT A+ LP + + + P Sbjct: 2 KDVIGLAETGSGKTGAFALPILQALLDNP 30 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 32.7 bits (71), Expect = 0.28 Identities = 12/21 (57%), Positives = 19/21 (90%) Frame = +2 Query: 509 GKNLVGVAQTGSGKTLAYILP 571 GK++V +A+TGSGKT A+++P Sbjct: 318 GKDVVAMARTGSGKTAAFLIP 338 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 396 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 I FE+ + + + V GYK+PTP+Q PI +R Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKR 913 Score = 32.3 bits (70), Expect = 0.37 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 512 KNLVGVAQTGSGKTLAYILPAIVHINNQPP 601 ++L+ AQTGSGKT A+++P + I + P Sbjct: 913 RDLMACAQTGSGKTAAFLIPILSRIYMEGP 942 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 32.3 bits (70), Expect = 0.37 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 628 ALVLAPTRELAQQIQQ 675 ALVLAPTRELAQQIQ+ Sbjct: 162 ALVLAPTRELAQQIQK 177 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 31.1 bits (67), Expect = 0.86 Identities = 13/39 (33%), Positives = 25/39 (64%) Frame = +2 Query: 482 SSRLADSYVGKNLVGVAQTGSGKTLAYILPAIVHINNQP 598 +S + + +GK++ A TG+GKT A++LP + + +P Sbjct: 38 ASTIPVALMGKDVCACAATGTGKTAAFMLPILERLLYRP 76 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +3 Query: 381 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 494 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 622 PIALVLAPTRELAQQIQQ 675 P ALVL+PTRELA QIQ+ Sbjct: 4 PQALVLSPTRELANQIQK 21 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 622 PIALVLAPTRELAQQIQQ 675 P ALVL+PTRELA QIQ+ Sbjct: 66 PQALVLSPTRELANQIQK 83 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +3 Query: 357 HEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSE 512 HEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ +++ Sbjct: 86 HEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLAD 140 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = +3 Query: 291 FYDPHPTVLKRSPYEVEEYRNN--HEVTVSGVEVHNPIQYFEEANFPDY 431 + D VL E EE NN H++ + + +HNP YFE+ + DY Sbjct: 217 YRDEDDGVLVPIEQEAEEEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/43 (23%), Positives = 23/43 (53%) Frame = +2 Query: 449 DNGLQRTDAYSSSRLADSYVGKNLVGVAQTGSGKTLAYILPAI 577 + G + + + G++++ A+ G+GKT AY++P + Sbjct: 64 EKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLL 106 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 405 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSERI*LA*LKRVPAK 551 FE+ + G+ G+ +P+PIQ + P+A++ R LA K K Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 29.1 bits (62), Expect = 3.5 Identities = 10/43 (23%), Positives = 23/43 (53%) Frame = +2 Query: 449 DNGLQRTDAYSSSRLADSYVGKNLVGVAQTGSGKTLAYILPAI 577 + G + + + G++++ A+ G+GKT AY++P + Sbjct: 64 EKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLL 106 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 405 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSERI*LA*LKRVPAK 551 FE+ + G+ G+ +P+PIQ + P+A++ R LA K K Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/46 (26%), Positives = 26/46 (56%) Frame = +2 Query: 440 RCKDNGLQRTDAYSSSRLADSYVGKNLVGVAQTGSGKTLAYILPAI 577 + K G+ + L + K+L+ ++TG+GK+L ++LP++ Sbjct: 174 KLKKMGITKPVPIQEKALPSVFSHKSLLIKSETGTGKSLVFLLPSV 219 >SB_25016| Best HMM Match : PDZ (HMM E-Value=5.6e-08) Length = 816 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/74 (21%), Positives = 33/74 (44%), Gaps = 1/74 (1%) Frame = +3 Query: 300 PHPTVLKRSPYEVEEYRNN-HEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTP 476 P P V + S Y +Y + H S ++ + ++ P Y+QQ ++ +G Sbjct: 341 PPPLVNQISQYNGSQYNQSLHYSLPSTFQISPVTPSLQPSSVPFYLQQDLEALGRISQPR 400 Query: 477 IQAQGWPIAMSERI 518 + Q P+A +++ Sbjct: 401 VSPQSRPLASGQQV 414 >SB_22560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/27 (48%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +2 Query: 500 SYVGKNLVGVAQTGSGKTLAY-ILPAI 577 SY G++ +GV TG GK++ + ILPA+ Sbjct: 192 SYTGRDGIGVLPTGYGKSVIFHILPAM 218 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 241 CSDLQRILFSHQILQILQIYCHRC-QIETN 155 CS +L +IL+ +YC +C Q ETN Sbjct: 14 CSLCSEVLTEPKILRCFHVYCQKCLQAETN 43 >SB_19645| Best HMM Match : Smr (HMM E-Value=8.2) Length = 346 Score = 27.9 bits (59), Expect = 8.0 Identities = 31/97 (31%), Positives = 40/97 (41%), Gaps = 11/97 (11%) Frame = +3 Query: 234 SEHASPRWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNNHEVTVSGVEVHNPIQ---- 401 SE AS S SLQ N N DP L R+ + R +VT ++ P Q Sbjct: 239 SEGASLMKLSTSLQSLNTNIKDPRAAFLNRTKIKDLLVRTITKVTFLQQQIAQPRQLTLT 298 Query: 402 -YFEEANFPDYV----QQG--VKTMGYKEPTPIQAQG 491 YF E + DYV Q G + G P+P + G Sbjct: 299 KYF-ETDSSDYVVELLQDGSAANSKGSDTPSPASSGG 334 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 172 CQIETNYRRICCLLQIWN-HRFHGYYSS 92 C + +YRR CC L +W H + Y+SS Sbjct: 218 CCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,537,201 Number of Sequences: 59808 Number of extensions: 400401 Number of successful extensions: 1049 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 963 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1048 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -