BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060144.seq (671 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 22 5.3 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 22 5.3 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 6.9 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.8 bits (44), Expect = 5.3 Identities = 14/56 (25%), Positives = 29/56 (51%) Frame = +3 Query: 249 HRILCEYLSSCNNETTKNTIFLSLFGGMESQRRLKVLSILASMAVSASSTPVLLAV 416 HR L ++ + + T++ + +S+ Q + V SIL + A++T ++L V Sbjct: 23 HRNLLDWSKTSLDNATEHKLPISMRFNEGHQLSIIVYSILMVFSAIANTTVLVLIV 78 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.8 bits (44), Expect = 5.3 Identities = 14/56 (25%), Positives = 29/56 (51%) Frame = +3 Query: 249 HRILCEYLSSCNNETTKNTIFLSLFGGMESQRRLKVLSILASMAVSASSTPVLLAV 416 HR L ++ + + T++ + +S+ Q + V SIL + A++T ++L V Sbjct: 23 HRNLLDWSKTSLDNATEHKLPISMRFNEGHQLSIIVYSILMVFSAIANTTVLVLIV 78 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -1 Query: 356 YLQSSLTFHTTKQRQEYCILCSLIIARGQIF 264 YL ++LT++ T ++ + +C L ++ IF Sbjct: 41 YLLTNLTYNNTNRKYYWLNVCCLNLSIVTIF 71 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,238 Number of Sequences: 336 Number of extensions: 3122 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17489640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -