BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060142.seq (681 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0226 + 26561673-26562908 28 7.9 02_04_0518 + 23601355-23602498,23603481-23603779 28 7.9 >05_06_0226 + 26561673-26562908 Length = 411 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +1 Query: 88 HQAIAFRCIGDSLYSQNEQDFISRMNPQKDLQDLMEESSDY 210 H IAF +GD L+S+ EQ + ++P + ++DL+ D+ Sbjct: 179 HHQIAFWHMGDRLFSEAEQ--MVWLSPLEQVEDLLYLDEDF 217 >02_04_0518 + 23601355-23602498,23603481-23603779 Length = 480 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = +1 Query: 112 IGDSLYSQNEQDFISRMNPQKDL--QDLMEESSDYWXXLLRXYFNEDVITLLVPRALR 279 +GD + E D +++MNP + EE + LL + +++ LLV LR Sbjct: 28 VGDEAVEEEEDDDVTKMNPPPATAGEREEEEEEEGIEGLLEPFTRNELLDLLVEACLR 85 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,631,451 Number of Sequences: 37544 Number of extensions: 255448 Number of successful extensions: 790 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 789 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -