BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060141.seq (678 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032623-4|CAA21510.1| 244|Caenorhabditis elegans Hypothetical ... 31 0.57 AL032623-3|CAA21509.1| 317|Caenorhabditis elegans Hypothetical ... 31 0.57 >AL032623-4|CAA21510.1| 244|Caenorhabditis elegans Hypothetical protein Y43F8B.2b protein. Length = 244 Score = 31.5 bits (68), Expect = 0.57 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 369 ARLTEPSRQIESSGRPSQYRSPSSLPVAAP 458 A L PS +SS + SQY S SLP+ P Sbjct: 200 ASLQSPSLSTDSSSKESQYSSTESLPIVTP 229 >AL032623-3|CAA21509.1| 317|Caenorhabditis elegans Hypothetical protein Y43F8B.2a protein. Length = 317 Score = 31.5 bits (68), Expect = 0.57 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 369 ARLTEPSRQIESSGRPSQYRSPSSLPVAAP 458 A L PS +SS + SQY S SLP+ P Sbjct: 273 ASLQSPSLSTDSSSKESQYSSTESLPIVTP 302 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,314,735 Number of Sequences: 27780 Number of extensions: 293213 Number of successful extensions: 811 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -