BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060131.seq (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 27 0.19 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 25 0.59 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 25 0.59 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 25 0.59 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 25 0.59 DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 24 1.4 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 5.5 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 22 5.5 DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory pro... 21 7.3 AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical pro... 21 7.3 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 26.6 bits (56), Expect = 0.19 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -2 Query: 249 CRLIIFYIVSRKRR*LLVHTVTVHLCFFS 163 CR++ ++I++ +L +VT+H+CF S Sbjct: 38 CRILKYFIIAIYVLTILTSSVTLHVCFNS 66 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.59 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -2 Query: 399 VIPTGAGSQDALLLVITQIII-KNTMFCLLDVGRKK 295 V+ +G S+ LL + +Q+ K T+FC D+GR+K Sbjct: 82 VLGSGVISKGTLLFMTSQLKPDKVTVFCNRDLGREK 117 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.59 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -2 Query: 399 VIPTGAGSQDALLLVITQIII-KNTMFCLLDVGRKK 295 V+ +G S+ LL + +Q+ K T+FC D+GR+K Sbjct: 82 VLGSGVISKGTLLFMTSQLKPDKVTVFCNRDLGREK 117 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.59 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -2 Query: 399 VIPTGAGSQDALLLVITQIII-KNTMFCLLDVGRKK 295 V+ +G S+ LL + +Q+ K T+FC D+GR+K Sbjct: 82 VLGSGVISKGTLLFMTSQLKPDKVTVFCNRDLGREK 117 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.59 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -2 Query: 399 VIPTGAGSQDALLLVITQIII-KNTMFCLLDVGRKK 295 V+ +G S+ LL + +Q+ K T+FC D+GR+K Sbjct: 82 VLGSGVISKGTLLFMTSQLKPDKVTVFCNRDLGREK 117 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 23.8 bits (49), Expect = 1.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 411 IDRAVIPTGAGSQDALLLVITQIIIKNTMFCLLDVGRKKP 292 ++ VIP D L + ++KN + CLLD GR P Sbjct: 17 LEEYVIPDNIDIDDILS---NERLLKNYVNCLLDKGRCTP 53 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 127 TKKNKKKRQVSNRLCEVHKH 68 TK K+ N++C +H H Sbjct: 492 TKGTNKQLNTLNKICALHHH 511 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -1 Query: 127 TKKNKKKRQVSNRLCEVHKH 68 TK K+ N++C +H H Sbjct: 217 TKGTNKQLNTLNKICALHHH 236 >DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory protein 12 protein. Length = 127 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 342 IIKNTMFCLLDVGRKKP 292 ++KN + CLLD G+ P Sbjct: 40 LLKNYVNCLLDRGKCSP 56 >AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical protein protein. Length = 127 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 342 IIKNTMFCLLDVGRKKP 292 ++KN + CLLD G+ P Sbjct: 40 LLKNYVNCLLDRGKCSP 56 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,018 Number of Sequences: 336 Number of extensions: 3725 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -