BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060131.seq (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1060 - 8363272-8365912,8366375-8366443,8366479-8366843,836... 29 4.7 07_03_1318 - 25751123-25751392,25751494-25751757,25752930-257530... 28 6.2 05_03_0289 - 11688733-11691342 28 8.2 >01_01_1060 - 8363272-8365912,8366375-8366443,8366479-8366843, 8367403-8367550,8367630-8367873,8368105-8368407, 8368639-8368851,8368927-8369002,8369533-8369561, 8369610-8369984,8371784-8371927,8374053-8374086 Length = 1546 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -2 Query: 690 LNVGEGYLYHESIDSGTQLTRQWYKSNPYIR 598 LNVG Y+ S DSG LTR WY P+++ Sbjct: 893 LNVGGAYI-PPSNDSG--LTRPWYDDTPFVQ 920 >07_03_1318 - 25751123-25751392,25751494-25751757,25752930-25753062, 25753698-25753771,25753869-25753994 Length = 288 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 160 QQHVMSGKFESTKKNKKKRQVSNRLCEVHKHHDLNA 53 +Q +SG +S ++K KRQ+SN + HD+ A Sbjct: 140 KQRELSGTLQSEDESKMKRQISNAKSKELSGHDIFA 175 >05_03_0289 - 11688733-11691342 Length = 869 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -2 Query: 690 LNVGEGYLYHESIDSGTQLTRQWYKSNPYI 601 LNVG Y+ + DSG L+R WY PYI Sbjct: 224 LNVGGSYVAPTN-DSG--LSRDWYDDTPYI 250 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,436,075 Number of Sequences: 37544 Number of extensions: 338226 Number of successful extensions: 611 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -