BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060131.seq (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77630.1 68414.m09038 peptidoglycan-binding LysM domain-conta... 28 5.2 At1g21880.2 68414.m02739 peptidoglycan-binding LysM domain-conta... 27 9.0 At1g21880.1 68414.m02738 peptidoglycan-binding LysM domain-conta... 27 9.0 >At1g77630.1 68414.m09038 peptidoglycan-binding LysM domain-containing protein contains Pfam profile PF01476: LysM domain Length = 423 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 347 CVITSSKASCEPAPVGITALSIFCREKVLRFG 442 CV+ S CEPA + ++ S+ CR G Sbjct: 253 CVLGSRSMYCEPASISVSCSSMRCRNSNFMLG 284 >At1g21880.2 68414.m02739 peptidoglycan-binding LysM domain-containing protein contains Pfam profile PF01476: LysM domain Length = 416 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 347 CVITSSKASCEPAPVGITALSIFCREKVLRFG 442 C + S CEPA + ++ S+ CR L G Sbjct: 256 CALGSRNLYCEPASLAVSCSSMQCRNSNLMLG 287 >At1g21880.1 68414.m02738 peptidoglycan-binding LysM domain-containing protein contains Pfam profile PF01476: LysM domain Length = 316 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 347 CVITSSKASCEPAPVGITALSIFCREKVLRFG 442 C + S CEPA + ++ S+ CR L G Sbjct: 256 CALGSRNLYCEPASLAVSCSSMQCRNSNLMLG 287 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,480,183 Number of Sequences: 28952 Number of extensions: 288750 Number of successful extensions: 591 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 591 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -