BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060130.seq (678 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28034| Best HMM Match : zf-CCHC (HMM E-Value=0.022) 28 6.0 SB_56034| Best HMM Match : GATA (HMM E-Value=5.6e-17) 28 8.0 >SB_28034| Best HMM Match : zf-CCHC (HMM E-Value=0.022) Length = 222 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -2 Query: 221 STCGRRGKVDYGCATRDSSPPKHLSLNCLYQ 129 S C RG Y C RDS PK + N Y+ Sbjct: 171 SQCNTRGHTAYSCRARDSRIPKPRNQNPNYR 201 >SB_56034| Best HMM Match : GATA (HMM E-Value=5.6e-17) Length = 297 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 552 RYQVLNVRCLKCYTXLKKKRKYIFC 478 RY+ +RCL+C+ KK+ K + C Sbjct: 250 RYKKYRIRCLRCWYIPKKEEKALPC 274 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,175,657 Number of Sequences: 59808 Number of extensions: 324257 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -