BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060130.seq (678 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 23 2.0 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 6.2 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.4 bits (48), Expect = 2.0 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -1 Query: 345 LSRHXNINIHNTLTFKINVHLKFILNKNGNPQNTRL 238 +S N IHN +K N + K+ N N N N +L Sbjct: 82 ISSLSNKTIHNNNNYKYNYNNKY--NYNNNNYNKKL 115 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 6.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 529 LFKMLYXFKKKEEIHILCNLVKKR 458 L +++ + EE++IL NL KKR Sbjct: 222 LSRLVRYVSQWEEVYILQNLQKKR 245 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,609 Number of Sequences: 438 Number of extensions: 3588 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -