BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060127.seq (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46525| Best HMM Match : Thymosin (HMM E-Value=0) 74 1e-13 SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) 36 0.029 SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) 32 0.48 SB_20129| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) 31 0.63 SB_39938| Best HMM Match : ANF_receptor (HMM E-Value=6.4e-14) 30 1.5 SB_57255| Best HMM Match : Atrophin-1 (HMM E-Value=0.91) 30 1.9 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 29 2.6 SB_49745| Best HMM Match : A2M_comp (HMM E-Value=0) 29 3.4 SB_19898| Best HMM Match : Merozoite_SPAM (HMM E-Value=3.7) 29 3.4 SB_34021| Best HMM Match : Zip (HMM E-Value=0) 29 3.4 SB_29288| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 28 5.9 SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_9325| Best HMM Match : Exo_endo_phos (HMM E-Value=0.081) 28 7.8 SB_8375| Best HMM Match : NUC153 (HMM E-Value=2.9) 28 7.8 >SB_46525| Best HMM Match : Thymosin (HMM E-Value=0) Length = 750 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/79 (48%), Positives = 49/79 (62%), Gaps = 2/79 (2%) Frame = +2 Query: 227 PEVF--IRRYREFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTE 400 PEV + FD+S+LKH E QEKNPLP KD I E + + ++ FD +KLKH + Sbjct: 674 PEVLPDVSAVASFDASKLKHVEVQEKNPLPTKDDITTESTETR--AEVKTFDHSKLKHVQ 731 Query: 401 TCEKNPLPTKDVIEQEKSA 457 T EKNPLP I QEK++ Sbjct: 732 TEEKNPLPDAKTIAQEKAS 750 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/66 (51%), Positives = 41/66 (62%) Frame = +2 Query: 251 REFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTK 430 + F+ S+L+H ET+EKN LP KD I EK F +G+E F KLKH ET EKNPLP Sbjct: 455 KSFEKSKLQHVETKEKNTLPTKDTIADEKRTAPF-SGVEVFQKNKLKHVETLEKNPLPDA 513 Query: 431 DVIEQE 448 I E Sbjct: 514 QNIRAE 519 Score = 68.5 bits (160), Expect = 5e-12 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 2/70 (2%) Frame = +2 Query: 251 REFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKF--LNGIENFDPTKLKHTETCEKNPLP 424 + FD S+LKH ET EKNPLP ++ E ++ + +FD +KLKH E EKNPLP Sbjct: 644 KSFDHSKLKHVETVEKNPLPSAAVLKEEMRPEVLPDVSAVASFDASKLKHVEVQEKNPLP 703 Query: 425 TKDVIEQEKS 454 TKD I E + Sbjct: 704 TKDDITTEST 713 Score = 68.1 bits (159), Expect = 6e-12 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 2/68 (2%) Frame = +2 Query: 254 EFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIE--NFDPTKLKHTETCEKNPLPT 427 +FD++ LKH +T+EKN LP + I+ E + ++F + E +F+ +KL+H ET EKN LPT Sbjct: 416 KFDAANLKHVQTKEKNTLPSDETIKQELQPDEFPDRAEVKSFEKSKLQHVETKEKNTLPT 475 Query: 428 KDVIEQEK 451 KD I EK Sbjct: 476 KDTIADEK 483 Score = 66.9 bits (156), Expect = 1e-11 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 2/76 (2%) Frame = +2 Query: 227 PEVFIRRYR--EFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTE 400 PEV R +FD+S+LKH ET+EK +P KD IEAE ++ +++FD +KLKH Sbjct: 522 PEVLPDRSEVAKFDTSKLKHVETKEKVVMPTKDVIEAEAIDSR--AEVKSFDHSKLKHVV 579 Query: 401 TCEKNPLPTKDVIEQE 448 T EKNPLPT + +E Sbjct: 580 TQEKNPLPTPQTLHEE 595 Score = 65.3 bits (152), Expect = 4e-11 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 2/66 (3%) Frame = +2 Query: 257 FDSSQLKHTETQEKNPLPDKDAIEAEK--EKNKFLNGIENFDPTKLKHTETCEKNPLPTK 430 F ++LKH ET EKNPLPD I AE E + + FD +KLKH ET EK +PTK Sbjct: 494 FQKNKLKHVETLEKNPLPDAQNIRAEMMPEVLPDRSEVAKFDTSKLKHVETKEKVVMPTK 553 Query: 431 DVIEQE 448 DVIE E Sbjct: 554 DVIEAE 559 Score = 60.9 bits (141), Expect = 9e-10 Identities = 28/64 (43%), Positives = 45/64 (70%) Frame = +2 Query: 257 FDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTKDV 436 FD ++LKH TQEK+ +P ++ I+ E ++ +++FD +KLKH ET EKNPLP+ V Sbjct: 610 FDHTKLKHVTTQEKSIMPSQEDIKEEAVDSRA--EVKSFDHSKLKHVETVEKNPLPSAAV 667 Query: 437 IEQE 448 +++E Sbjct: 668 LKEE 671 Score = 59.3 bits (137), Expect = 3e-09 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 2/68 (2%) Frame = +2 Query: 251 REFDSSQLKHTETQEKNPLPDKDAIEAEK-EKNK-FLNGIENFDPTKLKHTETCEKNPLP 424 + FD S+LKH TQEKNPLP + E KNK + + +FD TKLKH T EK+ +P Sbjct: 568 KSFDHSKLKHVVTQEKNPLPTPQTLHEELIPKNKPDRSEVASFDHTKLKHVTTQEKSIMP 627 Query: 425 TKDVIEQE 448 +++ I++E Sbjct: 628 SQEDIKEE 635 Score = 35.1 bits (77), Expect = 0.051 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 362 IENFDPTKLKHTETCEKNPLPTKDVIEQE 448 + FD LKH +T EKN LP+ + I+QE Sbjct: 414 VAKFDAANLKHVQTKEKNTLPSDETIKQE 442 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/40 (37%), Positives = 28/40 (70%) Frame = +3 Query: 102 LPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 221 +P+V D +S++ F+TS L+ V+T EK+V+P+ + + E Sbjct: 521 MPEVLPD-RSEVAKFDTSKLKHVETKEKVVMPTKDVIEAE 559 Score = 31.5 bits (68), Expect = 0.63 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +3 Query: 102 LPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 221 +PK D +S++ F+ + L+ V T EK ++PS ED+ E Sbjct: 597 IPKNKPD-RSEVASFDHTKLKHVTTQEKSIMPSQEDIKEE 635 >SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) Length = 413 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +3 Query: 90 SLKDLPKVATDLKSQLEGFNTSCL-RDVDTNEKIVLPSAEDVATEKTQKSLFD 245 SLK L K+ TDL+S ++G ++ L ++V+ K+V + +T K + S F+ Sbjct: 333 SLKALAKICTDLESNIQGIKSNPLAKEVERTNKLVYEIFKKFSTSKVEASSFE 385 >SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 32.3 bits (70), Expect = 0.36 Identities = 26/73 (35%), Positives = 32/73 (43%), Gaps = 5/73 (6%) Frame = +1 Query: 160 SVTSTPMRRLCFRLLKTSPLRRPRSLY-----STVSRV*FEPAEAHRDSGEEPASGQRCY 324 SVT T RRL R S L PRS+ T+ R+ A R GEE G+ Y Sbjct: 438 SVTGTFARRLVSRTTDASSLEDPRSVVVTSSPRTLGRISNGTTSARRVEGEEHVCGE--Y 495 Query: 325 RSGEGKEQIPERH 363 + KE +P H Sbjct: 496 KCSLCKEVVPPDH 508 >SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) Length = 385 Score = 31.9 bits (69), Expect = 0.48 Identities = 21/48 (43%), Positives = 28/48 (58%) Frame = -2 Query: 227 GLLSGDVFSRRKHNLLIGVDVTETAGVEAFELTLQVCGDLGEVFQGGS 84 GLL+GD+F R K N+LI VD T G + FEL + + E+ GS Sbjct: 74 GLLAGDIFRRPKANILISVDGV-TKG-DKFELPAKASFPVQEMAGLGS 119 >SB_20129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 31.5 bits (68), Expect = 0.63 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = -2 Query: 227 GLLSGDVFSRRKHNLLIGVDVTETAGVEAFEL 132 GLL+GD+F R K N+LI VD T G + FEL Sbjct: 51 GLLAGDIFRRPKANILISVDGV-TKG-DKFEL 80 >SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) Length = 1452 Score = 31.5 bits (68), Expect = 0.63 Identities = 20/64 (31%), Positives = 28/64 (43%) Frame = +2 Query: 257 FDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTKDV 436 +D Q K E PD+D +E E+E NG+E+ D K + PT DV Sbjct: 839 YDVKQRKRLEQHASYEAPDEDEMEIERE---LQNGLESGDEDDTKADAQRSETNSPTLDV 895 Query: 437 IEQE 448 Q+ Sbjct: 896 ETQQ 899 >SB_39938| Best HMM Match : ANF_receptor (HMM E-Value=6.4e-14) Length = 966 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 295 EEPASGQRCYRSGEGKEQIPERHRELRSH*AEAHGNVREEP 417 EEP+ + +G KE+ E RE R H + V+EEP Sbjct: 840 EEPSDEEESEEAGREKEEEEEDQREGRDHNDDEESVVKEEP 880 >SB_57255| Best HMM Match : Atrophin-1 (HMM E-Value=0.91) Length = 1249 Score = 29.9 bits (64), Expect = 1.9 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 72 SVSDTPSLKDLPKVATDLKSQLEGFNTSCLRDV-DTNEKIVLPSAEDVAT 218 S SD P+ D A+D+KS + T DV T++ V PSA DV T Sbjct: 617 SASDVPTTSDDQPSASDVKSTSDDQVTPPSSDVPTTSDDQVTPSASDVPT 666 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 20 ESSIPFLIKNILIHNGLLRE*HSLPERPPQGRHRPEESARRLQHQ 154 E S+PF N N ++ +P R PQG H + A+ +QH+ Sbjct: 224 EMSLPFKKHNTFRQNVDIK---GIPSRLPQGEHSDRKKAQEVQHK 265 >SB_49745| Best HMM Match : A2M_comp (HMM E-Value=0) Length = 1079 Score = 29.1 bits (62), Expect = 3.4 Identities = 25/81 (30%), Positives = 36/81 (44%) Frame = +3 Query: 3 HEAECTNLLSPSSSKIY*FTMACSVSDTPSLKDLPKVATDLKSQLEGFNTSCLRDVDTNE 182 HE C+ + + I FTM S T S+ LPK + Q+ F S L + D+ Sbjct: 355 HEKFCSKVKPRARQLIERFTMKAQSSQTVSILILPKEIGLIPIQV--FAVSAL-ESDSES 411 Query: 183 KIVLPSAEDVATEKTQKSLFD 245 + +L E V KTQ + D Sbjct: 412 RNLLVVPEGVGQIKTQSFVLD 432 >SB_19898| Best HMM Match : Merozoite_SPAM (HMM E-Value=3.7) Length = 446 Score = 29.1 bits (62), Expect = 3.4 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 2/69 (2%) Frame = +2 Query: 221 EDPEVFIRRYREFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHT- 397 E VF +R R + + + TET+E NP D +AE+ + G + T+ K T Sbjct: 274 EGKSVF-KRNRPTEPASVPSTETKEANPNVTADTKQAEQNEGSMSEGTTSKTITENKTTN 332 Query: 398 -ETCEKNPL 421 ET K L Sbjct: 333 METLRKEML 341 >SB_34021| Best HMM Match : Zip (HMM E-Value=0) Length = 808 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +2 Query: 215 H*EDPEVFIRRYREFDSSQLKHTETQEKNPLPDKDAIEA 331 H +P+ + + +FDS LKH ++ N +P+ + + Sbjct: 370 HEHEPKQDLYHHEDFDSYSLKHERVKQSNTVPNPSKVRS 408 >SB_29288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +2 Query: 275 KHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEK 412 +HTE + +P P K I+ E +++ + I+ KH+ +CE+ Sbjct: 212 RHTENAKSSPDPIKSEIDGEHSEDEKEHKIKVCPLVDKKHSHSCER 257 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +3 Query: 93 LKDLPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 221 L DL +V +LKS+ EG CL D++ + DV E Sbjct: 1125 LMDLSRVGEELKSENEGLQQKCL-DLEKQRDTIKQDLADVQKE 1166 >SB_46477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6116 Score = 27.9 bits (59), Expect = 7.8 Identities = 20/67 (29%), Positives = 29/67 (43%) Frame = -2 Query: 278 ASAGSNQTLDTVE*RLLGLLSGDVFSRRKHNLLIGVDVTETAGVEAFELTLQVCGDLGEV 99 A+A T DT+ L G S F+ ++ V + V ++ LTL V V Sbjct: 914 ATATDQDTSDTLTYALTGTNSAH-FAVSSTGMISTAHVLDRESVSSYSLTLSVSDGTANV 972 Query: 98 FQGGSVT 78 QG S+T Sbjct: 973 TQGVSIT 979 >SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1045 Score = 27.9 bits (59), Expect = 7.8 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 8/69 (11%) Frame = +2 Query: 227 PEVFIRRYREFDSSQL--KHTETQEKNPL---PDKDAIEAEKEK-NKFLN--GIENFDPT 382 PE +Y +FD ++ +TQEK PL DK+ EA + N+ + I N P Sbjct: 366 PEAKQGKY-DFDPTETPASRDKTQEKQPLEKTKDKEKEEANRRSYNRMASYESIGNIGPE 424 Query: 383 KLKHTETCE 409 K K ++CE Sbjct: 425 KSKSAKSCE 433 >SB_9325| Best HMM Match : Exo_endo_phos (HMM E-Value=0.081) Length = 249 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 202 LKTSPLRRPRSLYSTVSRV*FEPAEAHRDSGEE 300 L+ P+R PRS+ STV V + P A D ++ Sbjct: 129 LQLRPIRLPRSVSSTVLGVIYHPPHAKADDNQK 161 >SB_8375| Best HMM Match : NUC153 (HMM E-Value=2.9) Length = 433 Score = 27.9 bits (59), Expect = 7.8 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +1 Query: 130 VSSKASTPAVSVTSTPMRRLCFRLLKTSPLRRPRSLYSTVSRV*FEPAEAHRDSG 294 VSSK++ + ++ R F++LK P R + SRV H DSG Sbjct: 45 VSSKSANETSTTPNSSSSRSIFQMLKNPPSTRTVNCPICSSRVQMASINTHLDSG 99 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,060,892 Number of Sequences: 59808 Number of extensions: 404265 Number of successful extensions: 1357 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1346 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -