BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060127.seq (663 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 26 0.28 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.0 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 6.0 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 21 7.9 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 26.2 bits (55), Expect = 0.28 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 217 LRRPRSLYSTVSRV*FEPAEAHRDSGEEPASGQR 318 LRR R L +TV+R H DSG ++ QR Sbjct: 248 LRRSRMLTATVNRNHLSGGTNHWDSGRRKSAAQR 281 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 72 SVSDTPSLKDLPKVATDLKS 131 SVS PS+K + K ATD S Sbjct: 156 SVSCVPSVKHVAKCATDFSS 175 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +1 Query: 559 FYFWXLYNGNTAWAMATVQG 618 F++W +YN + A QG Sbjct: 265 FFYWRIYNAAVSTTKAINQG 284 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = +3 Query: 120 DLKSQLEGFNTSCLRDVDTNEKIV 191 +LKS L + C++++ T ++I+ Sbjct: 21 ELKSGLHTVQSVCMKEIGTAQQII 44 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,847 Number of Sequences: 438 Number of extensions: 3814 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -