BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060126.seq (686 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 2.3 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.1 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 9.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.5 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/55 (18%), Positives = 21/55 (38%) Frame = +3 Query: 375 GRVCEINEHGDAMCTASRTVPTRQTSRRMVCTNFNETWQSDCEVYASDAYASTTL 539 G+VC++ + VP ++ C + + + C S +Y T + Sbjct: 131 GKVCDVEMVSCKDAALRKVVPLKKLCNNGTCEDIGNSHRCHCSDGYSGSYCQTEI 185 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 557 QYHHVSNRVLXERGREMPD 613 +Y H N VL E G PD Sbjct: 308 RYGHTPNVVLDEEGNPCPD 326 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 284 NSGYFCLMVSFSSKLSDIP 228 N G CL+V+ + +SD P Sbjct: 195 NDGTKCLVVTDEASISDAP 213 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 471 NFNETWQSDCEVYASDAYASTTLISAVV 554 N+ WQS+C+ AS + T + VV Sbjct: 757 NYPVCWQSNCKKGASSDKPNFTKLIQVV 784 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,376 Number of Sequences: 336 Number of extensions: 2999 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -