BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060126.seq (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 27 0.55 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 27 0.55 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 27.1 bits (57), Expect = 0.55 Identities = 16/61 (26%), Positives = 28/61 (45%) Frame = +3 Query: 369 SAGRVCEINEHGDAMCTASRTVPTRQTSRRMVCTNFNETWQSDCEVYASDAYASTTLISA 548 SAG +C + GD +AS + + R+ T N + + +Y+S+TL S Sbjct: 646 SAGTICTVLAEGDKSVSASASNLPKIPERKSSLTKLNRSNSTASNGTLERSYSSSTLGST 705 Query: 549 V 551 + Sbjct: 706 L 706 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 27.1 bits (57), Expect = 0.55 Identities = 16/61 (26%), Positives = 28/61 (45%) Frame = +3 Query: 369 SAGRVCEINEHGDAMCTASRTVPTRQTSRRMVCTNFNETWQSDCEVYASDAYASTTLISA 548 SAG +C + GD +AS + + R+ T N + + +Y+S+TL S Sbjct: 647 SAGTICTVLAEGDKSVSASASNLPKIPERKSSLTKLNRSNSTASNGTLERSYSSSTLGST 706 Query: 549 V 551 + Sbjct: 707 L 707 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,751 Number of Sequences: 2352 Number of extensions: 12169 Number of successful extensions: 90 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -