BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060126.seq (686 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 41 1e-05 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 8.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.3 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 40.7 bits (91), Expect = 1e-05 Identities = 25/107 (23%), Positives = 51/107 (47%), Gaps = 4/107 (3%) Frame = +3 Query: 348 PCLKVHCSAGRVCEINEHGD-AMCTASRTVPTRQTSRRMVCTNFNETWQSDCEVYASDAY 524 PC +C G+ CE++ + A+C R P R R VC + + + + CE++ + + Sbjct: 81 PCASKYCGIGKECELSPNSTIAVCVCMRKCPRR---HRPVCASNGKIYANHCELHRAACH 137 Query: 525 ASTTLISAVVRNTTTFQIE--YYXNVAEKCLTALK-SEMSDFPRSHA 656 + ++L + + IE + T+LK S++ +P+S + Sbjct: 138 SGSSLTKSRLMRCLHHDIENAHIRRTLHMNRTSLKTSKIVSYPKSRS 184 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/48 (27%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +3 Query: 411 MCTASRTVP-TRQTSRRMVCTNFNETWQSDCEVYASDAYASTTLISAV 551 +C AS + + TS + + N+T +DC + D A T L++++ Sbjct: 16 LCLASTILSESAGTSCKWLSEGGNDTRSADCTLRVLDPGAITGLVASL 63 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/29 (27%), Positives = 16/29 (55%) Frame = -1 Query: 656 RMRTGEVRHLAFQCSQAFLGHVPVILDLK 570 R+ TGE H CS+ F+ +++ ++ Sbjct: 168 RIHTGERPHKCTVCSKTFIQSGQLVIHMR 196 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 214 QPPRCPRGR 188 QPP+CPR R Sbjct: 564 QPPQCPRFR 572 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,046 Number of Sequences: 438 Number of extensions: 3279 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -