BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060125.seq (716 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0643 - 10090720-10091007,10091121-10091228,10091314-100914... 29 2.8 01_06_1833 + 40208360-40208587,40208677-40209024,40209101-40209676 28 8.5 >03_02_0643 - 10090720-10091007,10091121-10091228,10091314-10091400, 10091488-10091568,10091669-10091803,10091919-10092140, 10092377-10092457,10092565-10092726,10092851-10093041, 10093190-10093331,10093449-10093547,10093668-10093806, 10094355-10094392 Length = 590 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -1 Query: 473 SDGLATV*RWSSGALAECEQQIRQFIIQNVXREHPHSFLINK 348 SDG+ W G A EQQ+ +++N + +PH+ +NK Sbjct: 441 SDGVGY--NWIDGLKAFTEQQVSDEMMKNAAKVYPHNTPVNK 480 >01_06_1833 + 40208360-40208587,40208677-40209024,40209101-40209676 Length = 383 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 486 DRR*TVTSRHQTVARPRWERQM 551 D R + + VARPRWERQM Sbjct: 348 DLRNVIRDWRRYVARPRWERQM 369 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,433,146 Number of Sequences: 37544 Number of extensions: 301325 Number of successful extensions: 473 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 473 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -