BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060124.seq (677 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 25 0.50 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 23 2.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.7 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 8.2 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 8.2 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 8.2 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 25.4 bits (53), Expect = 0.50 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -1 Query: 281 VPY-RPSRPDAGPSHDRGEHGARSIISCETGLAHTGAIVYYQRGNF 147 VPY R RPD ++ + ++I+ ++HTG +V+ G F Sbjct: 82 VPYNRVWRPDTILYNNADPQYSSAVINTNVIVSHTGEVVWLSHGIF 127 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 287 PSVPYRPSRPDAGPSHDRGEHGARSIISCETGLA 186 P+ +P+ + D GEH ++ E GLA Sbjct: 109 PTKSILEKKPELVDATDPGEHNGDTVTDVEAGLA 142 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 416 LRVAPEEHPVLLTEAPLNPKANREKM 493 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 573 SYHRYRAGLRRRCLPHRAHLPKDTA 647 ++ RYR L++RC H P+ T+ Sbjct: 339 NHPRYRQELQKRCKWMGIHEPETTS 363 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 573 SYHRYRAGLRRRCLPHRAHLPKDTA 647 ++ RYR L++RC H P+ T+ Sbjct: 339 NHPRYRQELQKRCKWMGIHEPETTS 363 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 180 GMCKAGFAGD 209 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,390 Number of Sequences: 438 Number of extensions: 4887 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -