BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060121.seq (685 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42130| Best HMM Match : rve (HMM E-Value=5.9e-13) 30 1.5 SB_52232| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_49875| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_40823| Best HMM Match : rve (HMM E-Value=1.4e-12) 30 2.0 SB_35536| Best HMM Match : zf-C2H2 (HMM E-Value=0.0069) 30 2.0 SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) 30 2.0 SB_8862| Best HMM Match : rve (HMM E-Value=3.3e-12) 30 2.0 SB_27965| Best HMM Match : Sec61_beta (HMM E-Value=0.84) 29 2.7 SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_12753| Best HMM Match : M (HMM E-Value=0.0006) 29 4.6 SB_13660| Best HMM Match : MtrG (HMM E-Value=3.4) 28 6.1 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 28 6.1 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_13355| Best HMM Match : HlyD (HMM E-Value=0.29) 28 6.1 SB_8968| Best HMM Match : zf-LSD1 (HMM E-Value=0.49) 28 6.1 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_9266| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_42130| Best HMM Match : rve (HMM E-Value=5.9e-13) Length = 975 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +1 Query: 112 KIYEKQDSETIYKQLLQLQEENVKLKSENGKLIEKCVTKEGE 237 ++ E+QD +YK++ L E VK S K +E+C++ G+ Sbjct: 259 ELQEQQDPNNLYKEIESLYIEEVK-SSNKIKCVEQCLSLNGK 299 >SB_52232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 112 KIYEKQDSETIYKQLLQLQEENVKLKSENGKLIEKCVTKEGE 237 ++ E+QD +YK++ L E +K S K +E+C++ G+ Sbjct: 180 ELQEQQDPNNLYKEIESLYIEEIK-SSNKIKCVEQCLSLNGK 220 >SB_49875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/69 (26%), Positives = 32/69 (46%) Frame = +1 Query: 46 IANKLMKDNLQVNVPDNLIMNDKIYEKQDSETIYKQLLQLQEENVKLKSENGKLIEKCVT 225 +ANKL++D +N PD + S+ +LL ++ K + G I +C Sbjct: 100 LANKLVQDKQYLNNPDRYGRSPLQNAVVKSDIRMVKLLLDARPDITHKDDRGDTIMQCAA 159 Query: 226 KEGEASILR 252 + G +IL+ Sbjct: 160 RTGNEAILK 168 >SB_40823| Best HMM Match : rve (HMM E-Value=1.4e-12) Length = 651 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 112 KIYEKQDSETIYKQLLQLQEENVKLKSENGKLIEKCVTKEGE 237 ++ E+QD +YK++ L E +K S K +E+C++ G+ Sbjct: 7 ELQEQQDPNNLYKEIESLYIEEIK-SSNKIKCVEQCLSLNGK 47 >SB_35536| Best HMM Match : zf-C2H2 (HMM E-Value=0.0069) Length = 657 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = +1 Query: 82 NVPDNLIMNDKIYEKQDSETIYKQLLQLQEENVKLKSENGKLIEKCVTKEGEASILR 252 N N +M D++ D I QL +EE K+KSE EKC E + ++L+ Sbjct: 320 NAERNQVMEDQVATLTDHSEI--QLNNAKEEIGKVKSELANCKEKCKRAEQQFNLLK 374 >SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) Length = 1702 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 112 KIYEKQDSETIYKQLLQLQEENVKLKSENGKLIEKCVTKEGE 237 ++ E+QD +YK++ L E +K S K +E+C++ G+ Sbjct: 921 ELQEQQDPNNLYKEIESLYIEEIK-SSNKIKCVEQCLSLNGK 961 >SB_8862| Best HMM Match : rve (HMM E-Value=3.3e-12) Length = 1358 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 112 KIYEKQDSETIYKQLLQLQEENVKLKSENGKLIEKCVTKEGE 237 ++ E+QD +YK++ L E +K S K +E+C++ G+ Sbjct: 371 ELQEQQDPNNLYKEIESLYIEEIK-SSNKIKCVEQCLSLNGK 411 >SB_27965| Best HMM Match : Sec61_beta (HMM E-Value=0.84) Length = 1737 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 237 SLNTKNQLKSIQVAADSARLEKMNVQEKLQMEWTEK 344 SLN + + K IQV + A+ E+ +LQ W EK Sbjct: 619 SLNPQTRNKIIQVLKEEAQTERQTKSNRLQELWKEK 654 >SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1925 Score = 29.1 bits (62), Expect = 3.5 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 5/86 (5%) Frame = +1 Query: 7 EEKCNRISSPLPGIANK---LMKDNLQV--NVPDNLIMNDKIYEKQDSETIYKQLLQLQE 171 EE+ R+ L + NK L K+N + N+ DN+I++ + E+QD+ ++K L L+ Sbjct: 881 EEQDARLWKTLDLLKNKGLTLNKENCEGAHNIHDNIILHGRTVEEQDAR-LWKTLDLLKN 939 Query: 172 ENVKLKSENGKLIEKCVTKEGEASIL 249 + + L EKCV + E + + Sbjct: 940 KGLTLNK------EKCVFRMSELTFM 959 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/39 (33%), Positives = 25/39 (64%) Frame = +1 Query: 82 NVPDNLIMNDKIYEKQDSETIYKQLLQLQEENVKLKSEN 198 N+ DN+I++ + E+QD+ ++K L L+ + + L EN Sbjct: 868 NIHDNIILHGRTVEEQDAR-LWKTLDLLKNKGLTLNKEN 905 >SB_31500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1446 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/64 (26%), Positives = 35/64 (54%) Frame = +1 Query: 55 KLMKDNLQVNVPDNLIMNDKIYEKQDSETIYKQLLQLQEENVKLKSENGKLIEKCVTKEG 234 KL ++ V LIM+++ ++++ I + L +LQE N + SEN +L + + + Sbjct: 433 KLTEERNAVIGEYRLIMSERDNVHRETDKIQEDLHKLQERNETISSENKQLYQLNKSLQD 492 Query: 235 EASI 246 E ++ Sbjct: 493 ELNV 496 >SB_12753| Best HMM Match : M (HMM E-Value=0.0006) Length = 304 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/28 (39%), Positives = 21/28 (75%) Frame = +1 Query: 124 KQDSETIYKQLLQLQEENVKLKSENGKL 207 ++ ++ + K++ +L EEN KL+SEN +L Sbjct: 211 QEQAKALTKEVCKLVEENTKLESENSQL 238 >SB_13660| Best HMM Match : MtrG (HMM E-Value=3.4) Length = 567 Score = 28.3 bits (60), Expect = 6.1 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Frame = +1 Query: 64 KDNLQVNVPDNLIMNDKIYEKQDSETIYKQLLQLQEENVKLKSENGKLIEKCVT--KEGE 237 KDN Q +VPD I + Y K D + K L++ + + +I++ K+ E Sbjct: 409 KDNPQASVPDEKINHKWTYIKLDDFKVPKVAFNLKKAIDQFNKDRATVIQQLDQRYKDVE 468 Query: 238 ASILRTS*KV 267 +I TS K+ Sbjct: 469 VTIATTSKKI 478 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 112 KIYE-KQDSETIYKQLLQLQEENVKLKSENGKLIEKCVTKEGEAS 243 KI E + +E++ QL + N +LK ENG L ++ + E EAS Sbjct: 1885 KIKELNEKNESLSSQLREAISANSQLKEENGILEQRIASLEKEAS 1929 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 124 KQDSETIYKQLLQLQEENVKLKSENGKLIEKCVTKEGEASI 246 K + + ++L Q+EN+K+ EN KL K + E I Sbjct: 989 KDKTLKVERELRDSQQENIKMNIENSKLSRKVSSLESSVEI 1029 >SB_13355| Best HMM Match : HlyD (HMM E-Value=0.29) Length = 327 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/47 (31%), Positives = 28/47 (59%) Frame = +1 Query: 103 MNDKIYEKQDSETIYKQLLQLQEENVKLKSENGKLIEKCVTKEGEAS 243 +N K++E+ E I K + +EN + + E +I++ VTKE +A+ Sbjct: 158 LNKKLFEQ---EIIAKNEWTVTQENYRFQKERMDIIKQSVTKEKQAN 201 >SB_8968| Best HMM Match : zf-LSD1 (HMM E-Value=0.49) Length = 379 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 46 IANKLMKDNLQVNVPDNLIMNDKIYEKQDSE-TIYKQLLQLQEENV 180 IA K ++ + +P+ L+ DK++ K D E + K + +QEENV Sbjct: 325 IAAKNFQELSKNLIPETLLCLDKVFFKLDDEGKVVKVMKVVQEENV 370 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/70 (27%), Positives = 34/70 (48%) Frame = +1 Query: 82 NVPDNLIMNDKIYEKQDSETIYKQLLQLQEENVKLKSENGKLIEKCVTKEGEASILRTS* 261 N+P + I+ ++ + Q + YKQ + + ++K G L E+C K LR + Sbjct: 75 NLPADQIVLEEKRKAQSAINRYKQFINIYPTHLKDPFHIGVLCEQCKHK-ATRKTLRENR 133 Query: 262 KVFKLPLTVP 291 +LPL +P Sbjct: 134 HDMELPLLLP 143 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = +1 Query: 64 KDNLQVNVPDNLIMNDKIYEKQDSETIYKQLLQ 162 KD ++ N+ + ++ND+ EK++ ET K LLQ Sbjct: 3452 KDEIKHNMNISKVLNDRTTEKENLETERKCLLQ 3484 >SB_9266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1490 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/45 (37%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = +1 Query: 76 QVNVPDNLIM-NDKIYEKQDSETIYKQLLQLQEENVKLKSENGKL 207 Q+++P N M +D+I EK+ + +++ L+EEN LKS+N L Sbjct: 113 QIHLPFNEKMTHDQIEEKE----LLRRVSSLEEENTVLKSKNAAL 153 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,132,826 Number of Sequences: 59808 Number of extensions: 297892 Number of successful extensions: 709 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -