BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060121.seq (685 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK130893-1|BAC85454.1| 695|Homo sapiens protein ( Homo sapiens ... 32 2.2 AB046791-1|BAB13397.2| 1779|Homo sapiens KIAA1571 protein protein. 32 2.2 >AK130893-1|BAC85454.1| 695|Homo sapiens protein ( Homo sapiens cDNA FLJ27383 fis, clone UBA08549. ). Length = 695 Score = 31.9 bits (69), Expect = 2.2 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 34 PLPGIANKLMKDNLQVNV--PDNLIMNDKIYEKQDSETIYKQLLQLQ 168 PL + NK+ N ++N+ +++ ++DK Y DSE IY + LQ Sbjct: 147 PLQSVTNKIPGANKEINLLREEHVCLDDKGYVPSDSEIIYVSNIPLQ 193 >AB046791-1|BAB13397.2| 1779|Homo sapiens KIAA1571 protein protein. Length = 1779 Score = 31.9 bits (69), Expect = 2.2 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +1 Query: 34 PLPGIANKLMKDNLQVNV--PDNLIMNDKIYEKQDSETIYKQLLQLQ 168 PL + NK+ N ++N+ +++ ++DK Y DSE IY + LQ Sbjct: 717 PLQSVTNKIPGANKEINLLREEHVCLDDKGYVPSDSEIIYVSNIPLQ 763 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,653,833 Number of Sequences: 237096 Number of extensions: 1351383 Number of successful extensions: 3076 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2807 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3076 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -