BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060120.seq (679 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF077537-14|AAC26283.1| 556|Caenorhabditis elegans Hypothetical... 28 5.3 >AF077537-14|AAC26283.1| 556|Caenorhabditis elegans Hypothetical protein F16G10.15 protein. Length = 556 Score = 28.3 bits (60), Expect = 5.3 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = -2 Query: 444 VFNKLRKIFVCLREEFPPNLLSVK*KLFVYLRELKCWFDSNIPKIIYIYLHLLKNPLPI 268 V+ + + F ++ P N LS+ LR++ FDSN K +YI +N L I Sbjct: 111 VYKQFKSCFKKQQKRIPVNTLSLNIDHVSKLRDILQCFDSNTLKDLYITYRKEENQLEI 169 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,620,947 Number of Sequences: 27780 Number of extensions: 239961 Number of successful extensions: 364 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 364 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -