BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060119.seq (685 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY058376-1|AAL13605.1| 499|Drosophila melanogaster GH14326p pro... 29 7.8 AE013599-3349|AAF46811.1| 499|Drosophila melanogaster CG3045-PA... 29 7.8 >AY058376-1|AAL13605.1| 499|Drosophila melanogaster GH14326p protein. Length = 499 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +3 Query: 165 RPREREMGRLFMMRMQCDVTPRAYSQILHKATCECVEREL 284 +P+E+ + ++ ++ Q V PR Y +L + CE +E + Sbjct: 444 KPKEKVLAQVILL--QDSVNPRQYQPLLERKRCESLENRI 481 >AE013599-3349|AAF46811.1| 499|Drosophila melanogaster CG3045-PA protein. Length = 499 Score = 28.7 bits (61), Expect = 7.8 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +3 Query: 165 RPREREMGRLFMMRMQCDVTPRAYSQILHKATCECVEREL 284 +P+E+ + ++ ++ Q V PR Y +L + CE +E + Sbjct: 444 KPKEKVLAQVILL--QDSVNPRQYQPLLERKRCESLENRI 481 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,020,651 Number of Sequences: 53049 Number of extensions: 411199 Number of successful extensions: 523 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 523 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2992560750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -