BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060117.seq (559 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 4.1 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 4.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.1 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 21 5.4 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 5.4 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 21 7.2 EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 pr... 21 7.2 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 21 7.2 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 21 7.2 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 7.2 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 7.2 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 7.2 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 7.2 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 7.2 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 7.2 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 7.2 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 7.2 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 7.2 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.8 bits (44), Expect = 4.1 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = -1 Query: 247 RTAETVPGYCQ*QAHRHGSRKERPLRRIVTCPYRRVSLG 131 R T+PG + AH +K R +R C Y LG Sbjct: 96 RLVWTLPGKTKMIAHLKDKKKIRAKKRWSQCMYMYFLLG 134 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.8 bits (44), Expect = 4.1 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = -1 Query: 247 RTAETVPGYCQ*QAHRHGSRKERPLRRIVTCPYRRVSLG 131 R T+PG + AH +K R +R C Y LG Sbjct: 410 RLVWTLPGKTKMIAHLKDKKKIRAKKRWSQCMYMYFLLG 448 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.1 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = -1 Query: 247 RTAETVPGYCQ*QAHRHGSRKERPLRRIVTCPYRRVSLG 131 R T+PG + AH +K R +R C Y LG Sbjct: 643 RLVWTLPGKTKMIAHLKDKKKIRAKKRWSQCMYMYFLLG 681 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 4.1 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = -1 Query: 247 RTAETVPGYCQ*QAHRHGSRKERPLRRIVTCPYRRVSLG 131 R T+PG + AH +K R +R C Y LG Sbjct: 643 RLVWTLPGKTKMIAHLKDKKKIRAKKRWSQCMYMYFLLG 681 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 21.4 bits (43), Expect = 5.4 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 378 GRHHRAHSGRQPQAIR 425 GRH+++ S RQP+ R Sbjct: 208 GRHNQSRSKRQPKTGR 223 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 5.4 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 161 DNTAEWSFLAASVPMCLSLAIAGNSFCGSDVEDSSSIPKL 280 DN + A S P LSL++A NS +E + +I L Sbjct: 453 DNVSLSQVPALSTPNLLSLSLAFNSLPTVALEVAGNISSL 492 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 32 YGLWNLRATNTG 67 YG++N+RA TG Sbjct: 331 YGVFNIRARRTG 342 >EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 protein. Length = 237 Score = 21.0 bits (42), Expect = 7.2 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 161 DNTAEWSFLAASVPMCLSLAIAGNSFCGSDVEDSSS 268 D A A VP C + +AG C + E S+S Sbjct: 131 DREARVCMWADQVPECKNEEVAGGFTCPAPGEVSNS 166 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 21.0 bits (42), Expect = 7.2 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 161 DNTAEWSFLAASVPMCLSLAIAGNSFCGSDVEDSSS 268 D A A VP C + +AG C + E S+S Sbjct: 131 DREARVCMWADQVPECKNEEVAGGFTCPAPGEVSNS 166 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 32 YGLWNLRATNTG 67 YG++N+RA TG Sbjct: 331 YGVFNIRARRTG 342 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 7.2 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 192 AARNDHSAVLSPVHTAEYLWVPANXALVSRKGL*TPSARSSSP 64 A+ D S +P + L P+N GL +P + S+SP Sbjct: 111 ASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 7.2 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 192 AARNDHSAVLSPVHTAEYLWVPANXALVSRKGL*TPSARSSSP 64 A+ D S +P + L P+N GL +P + S+SP Sbjct: 111 ASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 7.2 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 192 AARNDHSAVLSPVHTAEYLWVPANXALVSRKGL*TPSARSSSP 64 A+ D S +P + L P+N GL +P + S+SP Sbjct: 111 ASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 7.2 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 192 AARNDHSAVLSPVHTAEYLWVPANXALVSRKGL*TPSARSSSP 64 A+ D S +P + L P+N GL +P + S+SP Sbjct: 111 ASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 7.2 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 192 AARNDHSAVLSPVHTAEYLWVPANXALVSRKGL*TPSARSSSP 64 A+ D S +P + L P+N GL +P + S+SP Sbjct: 111 ASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 7.2 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 192 AARNDHSAVLSPVHTAEYLWVPANXALVSRKGL*TPSARSSSP 64 A+ D S +P + L P+N GL +P + S+SP Sbjct: 67 ASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 109 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 7.2 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 192 AARNDHSAVLSPVHTAEYLWVPANXALVSRKGL*TPSARSSSP 64 A+ D S +P + L P+N GL +P + S+SP Sbjct: 111 ASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.0 bits (42), Expect = 7.2 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 192 AARNDHSAVLSPVHTAEYLWVPANXALVSRKGL*TPSARSSSP 64 A+ D S +P + L P+N GL +P + S+SP Sbjct: 111 ASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 7.2 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 192 AARNDHSAVLSPVHTAEYLWVPANXALVSRKGL*TPSARSSSP 64 A+ D S +P + L P+N GL +P + S+SP Sbjct: 111 ASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLTSPLSVSTSP 153 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,311 Number of Sequences: 336 Number of extensions: 2567 Number of successful extensions: 19 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -