Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060117.seq
         (559 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              23   1.6  
AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein ...    21   6.4  

>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 11/44 (25%), Positives = 19/44 (43%)
 Frame = -2

Query: 504 VLEQGPHXRQPVHRVLVXQSVPXVEQRVSLAVGVPNEHGGAVXV 373
           +L   P   +P H +     +P  ++ V    G+P   G A+ V
Sbjct: 514 ILVYEPSACRPRHEIRSTDVIPGTQEHVCGVKGIPCSWGRAINV 557


>AY338499-1|AAR08420.1|  500|Apis mellifera Kruppel-like protein 1
           protein.
          Length = 500

 Score = 21.4 bits (43), Expect = 6.4
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +3

Query: 381 RHHRAHSGRQP 413
           RH+R H+G +P
Sbjct: 109 RHYRTHTGEKP 119


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 145,234
Number of Sequences: 438
Number of extensions: 2932
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 16072521
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)