BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060116.seq (672 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1475 + 33856351-33856582,33857614-33857781,33858156-338582... 32 0.36 >04_04_1475 + 33856351-33856582,33857614-33857781,33858156-33858261, 33858391-33858442,33858525-33858642,33858736-33858766, 33858962-33858985,33859075-33859199,33860087-33860168, 33860319-33860441,33860539-33860592,33860669-33860738, 33861276-33861309,33861824-33862170 Length = 521 Score = 32.3 bits (70), Expect = 0.36 Identities = 18/76 (23%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = +1 Query: 376 PLPCLET*GRSFNSCIVSQLSRLINWNNDCIAVGTSQDAECSFX*LGRRDSRNIKHMGVI 555 P P L+ G + + ++ ++ CI+ GT+Q+ E + G++ S N K + ++ Sbjct: 306 PKPLLDLSGWNIRCMASGNMHHVVGADDSCISWGTAQNGELGYGPNGQKSSANPKKVDIL 365 Query: 556 -SVHVQNSRAGLSXRA 600 +HV + G A Sbjct: 366 EGMHVISVGCGYGLSA 381 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,951,610 Number of Sequences: 37544 Number of extensions: 297682 Number of successful extensions: 482 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 482 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -