BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060114.seq (644 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_03_0151 - 10816905-10816977,10817090-10817421,10817884-108179... 29 2.4 >11_03_0151 - 10816905-10816977,10817090-10817421,10817884-10817967, 10818045-10818092,10818233-10818287,10818378-10818433, 10818543-10818627,10819810-10819844 Length = 255 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = +3 Query: 195 LP*WKP--PSAISVTSFNFTHIGKFQAHDINNQQ 290 LP ++P PS +S+T F FT IG+F + ++Q Sbjct: 134 LPWYQPLDPSQLSLTHFQFTRIGRFLGQTLVSKQ 167 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,288,490 Number of Sequences: 37544 Number of extensions: 308084 Number of successful extensions: 657 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -