BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060114.seq (644 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 2.7 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 24 3.6 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 23 8.3 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 2.7 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +2 Query: 50 AISVTSFNFTHIR*IPSSCKILIPYSSSMAFTNLVNTLANTIHRDAITAPLVETA 214 ++ + +F H++ S I+ YS L LAN +HR+A ++ ++ A Sbjct: 1073 SMPIQAFEMIHLKTYQGS--IIQKYSRLSCILELDTMLANHLHREAFSSSELQKA 1125 Score = 23.0 bits (47), Expect = 8.3 Identities = 12/54 (22%), Positives = 25/54 (46%) Frame = +3 Query: 429 TLPISGKFQAHDINNQQSQLVPGFCAYMAFTNLVDTLANTIHRDAITAPLVKTA 590 ++PI F+ + Q ++ + L LAN +HR+A ++ ++ A Sbjct: 1073 SMPIQA-FEMIHLKTYQGSIIQKYSRLSCILELDTMLANHLHREAFSSSELQKA 1125 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 24.2 bits (50), Expect = 3.6 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 414 PSQASTLPISGKFQAHDINNQQSQLVPG 497 P AST P G FQ+ NN S ++PG Sbjct: 10 PGAASTTPSPGAFQSLARNN--SYVIPG 35 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/36 (27%), Positives = 14/36 (38%) Frame = +3 Query: 387 PSGNRHQQFPSQASTLPISGKFQAHDINNQQSQLVP 494 P QQ+ S P+ K + HD +L P Sbjct: 318 PQQQHQQQYHSHPHHTPVQFKTELHDNTQYDEELSP 353 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 594,255 Number of Sequences: 2352 Number of extensions: 10077 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -