BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060113.seq (656 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 29 3.3 SB_52473| Best HMM Match : MMR_HSR1 (HMM E-Value=0.0026) 28 5.8 SB_27495| Best HMM Match : VWA (HMM E-Value=0) 28 7.7 >SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1636 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = -3 Query: 402 KTTHLSSVT----PCRGHCVVFGCSSSYDISGAASQRSARP 292 KTT +S +T P G+ VV GCS + DISG S P Sbjct: 348 KTTLMSMLTGLFPPTSGNAVVNGCSITDDISGVRSSLDLCP 388 >SB_52473| Best HMM Match : MMR_HSR1 (HMM E-Value=0.0026) Length = 936 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 19 LFITQKKTIHHTKVFIERYNRVHSFCLTVLKSIFH 123 LF+TQ T+ HTK Y + +S C T S+ H Sbjct: 894 LFVTQSPTLCHTKPNSLCYTKPNSLCHTKPDSLCH 928 >SB_27495| Best HMM Match : VWA (HMM E-Value=0) Length = 1064 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -2 Query: 322 GSGVTALGPSLLLERAYFLFXRRIARDWTSQRLRRPVLRPA 200 GSG T+ ++ + AY F RR + W+ RLR V+R A Sbjct: 543 GSGKTSCKTAIKSKYAYD-FLRRDGKPWSRDRLRFAVIRKA 582 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,573,202 Number of Sequences: 59808 Number of extensions: 406759 Number of successful extensions: 1002 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1002 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -