BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060113.seq (656 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U55364-6|AAA97973.1| 2541|Caenorhabditis elegans Hypothetical pr... 28 6.7 AL021172-1|CAA15962.1| 315|Caenorhabditis elegans Hypothetical ... 28 6.7 AF056579-1|AAC78601.1| 315|Caenorhabditis elegans high mobility... 28 6.7 U23174-2|AAM97992.1| 100|Caenorhabditis elegans Inhibitor of se... 27 8.9 AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 prote... 27 8.9 AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 prote... 27 8.9 >U55364-6|AAA97973.1| 2541|Caenorhabditis elegans Hypothetical protein F21C10.7 protein. Length = 2541 Score = 27.9 bits (59), Expect = 6.7 Identities = 19/76 (25%), Positives = 37/76 (48%), Gaps = 3/76 (3%) Frame = +1 Query: 1 GTRCDSLFITQKKTIHHTKVFIERYNRVHSFCLTVLKSIFHKINRTVAAMEVDRIASDSE 180 G R L ++ +H+ K + R +R+H+F L KS+ ++N V M+ A E Sbjct: 271 GGRISHLSGRIEEFLHYLKTRMNRSHRIHAF-LQAAKSMVSQLNMMVEDMKCANAAMAGE 329 Query: 181 NVAMDEK---PVVEQG 219 + ++ P++ +G Sbjct: 330 LAPLAKQKASPLIHEG 345 >AL021172-1|CAA15962.1| 315|Caenorhabditis elegans Hypothetical protein Y17G7A.1 protein. Length = 315 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +1 Query: 94 CLTVLKSIFHKINRTVAAMEVDRIASDSENVAMDEKPVVEQGAGDAATSN 243 C +++ HK+N T+A + V + +EN +E G+ N Sbjct: 26 CADLIEKELHKLNATIARVPVGEFVAYAENAVKNETDSEAVGSSSVKREN 75 >AF056579-1|AAC78601.1| 315|Caenorhabditis elegans high mobility group protein I beta protein. Length = 315 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +1 Query: 94 CLTVLKSIFHKINRTVAAMEVDRIASDSENVAMDEKPVVEQGAGDAATSN 243 C +++ HK+N T+A + V + +EN +E G+ N Sbjct: 26 CADLIEKELHKLNATIARVPVGEFVAYAENAVKNETDSEAVGSSSVKREN 75 >U23174-2|AAM97992.1| 100|Caenorhabditis elegans Inhibitor of serine protease likeprotein protein 1 protein. Length = 100 Score = 27.5 bits (58), Expect = 8.9 Identities = 19/66 (28%), Positives = 24/66 (36%) Frame = -3 Query: 408 LVKTTHLSSVTPCRGHCVVFGCSSSYDISGAASQRSARPCC*NERISCSCDESLGIGRRS 229 +VKT V PC + V CSS + G Q R C + C C G R Sbjct: 30 IVKTEETEEVKPCGLNEVWMVCSSCEEECGKTPQPCPRIC---QPARCQCPAHKGYRRDG 86 Query: 228 VSGALF 211 +F Sbjct: 87 QGNCIF 92 >AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 protein protein. Length = 18519 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +3 Query: 234 DVQSRAIRRXNKKYARSNSKDGPSAVTPLPKYRSWKNSRRPRNGHGRGLPKKGE 395 D + +R NKK ++ K+G S K + + S + L KKGE Sbjct: 10711 DSDAMEVRGLNKKLSKKGGKEGTSTEKSSSKTKKQEKSALSVQEMNKSLKKKGE 10764 >AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 protein protein. Length = 18534 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +3 Query: 234 DVQSRAIRRXNKKYARSNSKDGPSAVTPLPKYRSWKNSRRPRNGHGRGLPKKGE 395 D + +R NKK ++ K+G S K + + S + L KKGE Sbjct: 10711 DSDAMEVRGLNKKLSKKGGKEGTSTEKSSSKTKKQEKSALSVQEMNKSLKKKGE 10764 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,330,843 Number of Sequences: 27780 Number of extensions: 290475 Number of successful extensions: 720 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -