BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060103.seq (658 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 21 6.7 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 21 8.9 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/30 (26%), Positives = 17/30 (56%) Frame = +3 Query: 153 LIMMTITIVSTGMRYGRAYLSRRQRNHRFI 242 L+M +TI+ + + + + S +N +FI Sbjct: 27 LVMSAVTIILSSLIFNQEQWSSLNKNFQFI 56 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 575 VTFAALIGSVCCAPTLTWTTK 637 V FAA++G P +TTK Sbjct: 7 VAFAAVLGLALARPQEKYTTK 27 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,112 Number of Sequences: 336 Number of extensions: 2885 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -