BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060102.seq (679 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 27 0.19 AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase l... 24 1.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.3 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 23 3.0 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 21 7.0 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 9.3 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 21 9.3 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 9.3 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 26.6 bits (56), Expect = 0.19 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 412 VEKLGNEEDDKLAVISDVESIITFYC 489 VE+ G E K ++SD E+ +TF+C Sbjct: 29 VEESGFENFVKTYLVSDFENYVTFFC 54 >AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase like protein E1 protein. Length = 139 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 649 WQGTPFFEQPFGVSNFK 599 ++G P+ + PFGV FK Sbjct: 1 FEGMPYAQPPFGVLRFK 17 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 346 LLFDEIFDLPNQNELRDDVKKFVEKL 423 + FD+ F++ + N+ V +FV+ L Sbjct: 615 IFFDDAFEISDHNDDETQVNRFVKLL 640 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 346 LLFDEIFDLPNQNELRDDVKKFVEKL 423 + FD+ F++ + N+ V +FV+ L Sbjct: 615 IFFDDAFEISDHNDDETQVNRFVKLL 640 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 346 LLFDEIFDLPNQNELRDDVKKFVEKL 423 + FD+ F++ + N+ V +FV+ L Sbjct: 615 IFFDDAFEISDHNDDETQVNRFVKLL 640 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +1 Query: 346 LLFDEIFDLPNQNELRDDVKKFVEKL 423 + FD+ F++ + N+ V +FV+ L Sbjct: 615 IFFDDAFEISDHNDDETQVNRFVKLL 640 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 637 PFFEQPFGVSNFKI 596 PFF QP + NF++ Sbjct: 263 PFFRQPLDLYNFRV 276 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 21.4 bits (43), Expect = 7.0 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +1 Query: 361 IFDLPNQNELRDDVKKFVEKLGNEEDDKLAVISDVE 468 +FD + R VK FV+ L + D + + ++E Sbjct: 456 LFDTSRNHRDRAMVKIFVDLLTSFSDSSIPKVKEIE 491 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.0 bits (42), Expect = 9.3 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 373 PNQNELRDDVKKFVEKLGNEEDDKLAV 453 P E DD+++F+E E D K A+ Sbjct: 144 PLMQECVDDLRRFLEDHTEEIDVKTAM 170 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 21.0 bits (42), Expect = 9.3 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +1 Query: 322 CQDAGNQLLLFDEIFDLPNQNELRDDVKKFVEKLGNEE 435 C++A L+ I E RDD K KL N++ Sbjct: 161 CKEANKTAFLWYHIKIDREDEEARDDFIKLGIKLSNDK 198 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 9.3 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -3 Query: 278 IFFPFVNA*FLVRYIHREEQTLVLSTKYH 192 I FPF F+ ++ E+ L KY+ Sbjct: 169 ISFPFPETQFIAVTAYQNEEVTALKIKYN 197 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,981 Number of Sequences: 336 Number of extensions: 3340 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -