BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060099.seq (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08680.2 68416.m01009 leucine-rich repeat transmembrane prote... 30 1.6 At3g08680.1 68416.m01008 leucine-rich repeat transmembrane prote... 30 1.6 >At3g08680.2 68416.m01009 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profile: PF00069 Eukaryotic protein kinase domain, PF00560 leucine Rich Repeat (5 copies) Length = 640 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +3 Query: 414 AVRAGRHPRQRGHAATQGRGAQEASQEEA--FWNSVVTSCFQDLYKLTGEVLGEGAYAS 584 AV + R A G G QEA + + F S +DL + + EVLG+G+Y + Sbjct: 296 AVPKAKPGRSDNKAEEFGSGVQEAEKNKLVFFEGSSYNFDLEDLLRASAEVLGKGSYGT 354 >At3g08680.1 68416.m01008 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profile: PF00069 Eukaryotic protein kinase domain, PF00560 leucine Rich Repeat (5 copies) Length = 640 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +3 Query: 414 AVRAGRHPRQRGHAATQGRGAQEASQEEA--FWNSVVTSCFQDLYKLTGEVLGEGAYAS 584 AV + R A G G QEA + + F S +DL + + EVLG+G+Y + Sbjct: 296 AVPKAKPGRSDNKAEEFGSGVQEAEKNKLVFFEGSSYNFDLEDLLRASAEVLGKGSYGT 354 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,585,503 Number of Sequences: 28952 Number of extensions: 218925 Number of successful extensions: 675 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -