BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060098.seq (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 26 1.3 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 25 1.7 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 25 1.7 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 5.0 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 24 5.0 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 5.0 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 5.0 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 24 5.0 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 24 5.0 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 24 5.0 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 24 5.0 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 24 5.0 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 24 5.0 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 24 5.0 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 24 5.0 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 24 5.0 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 24 5.0 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 24 5.0 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 607 DRRCLIISLLFEPAAGVAAQVEAPDLVV 524 DR CLII F A +A AP ++V Sbjct: 505 DRLCLIIFTFFTIVATIAVLFSAPHIIV 532 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 25.4 bits (53), Expect = 1.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 219 QIVDGLRVPLLPDTEKLHREESVFSHDHEVDEEAS 115 Q++ +R PLL D EKL + + + + D E+S Sbjct: 30 QLLPAVRRPLLSDAEKLEQRLLAPNRNADFDNESS 64 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -1 Query: 607 DRRCLIISLLFEPAAGVAAQVEAPDLVV 524 DR CLII LF A +A AP +V Sbjct: 481 DRLCLIIFTLFTIIATLAVLFSAPHFIV 508 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 354 IIHQGMRNWALNFGL 398 I H +RNWA+ FG+ Sbjct: 45 IPHNEVRNWAIRFGV 59 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 23.8 bits (49), Expect = 5.0 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = -3 Query: 512 TDERNGGQPPHELEW---VH-PQALVHTGSVREERRQRGFKYET 393 + + GG PPH W VH Q+ V+ + +R +Y+T Sbjct: 249 SSSKKGGPPPHIYPWMKRVHIGQSTVNANGETKRQRTSYTRYQT 292 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 80 IIKSVEHHAPANYEFSYSVHDEHTG 104 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTG 96 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTG 96 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTG 96 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 80 IIKSVEHHAPANYEFSYSVHDEHTG 104 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTG 96 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 80 IIKSVEHHAPANYEFSYSVHDEHTG 104 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 104 IIKSVEHHAPANYEFSYSVHDEHTG 128 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTG 96 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 80 IIKSVEHHAPANYEFSYSVHDEHTG 104 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTG 96 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 80 IIKSVEHHAPANYEFSYSVHDEHTG 104 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 589 LLNSADHCPPSXIKLSHRVHNVHFG 663 ++ S +H P+ + S+ VH+ H G Sbjct: 72 IIKSVEHHAPANYEFSYSVHDEHTG 96 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,906 Number of Sequences: 2352 Number of extensions: 15760 Number of successful extensions: 44 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -