BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060098.seq (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 28 0.071 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 4.7 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 4.7 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 6.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 8.1 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.1 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 28.3 bits (60), Expect = 0.071 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 607 DRRCLIISLLFEPAAGVAAQVEAPDLVV 524 DR CLII LF A +A + AP ++V Sbjct: 527 DRMCLIIFTLFTIIATIAVLLSAPHIIV 554 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 187 KQWDSKAINDLTDSYGQEWTY 249 K W + I DLT S ++ TY Sbjct: 91 KPWSTLPIEDLTKSDNEDITY 111 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 187 KQWDSKAINDLTDSYGQEWTY 249 K W + I DLT S ++ TY Sbjct: 129 KPWSTLPIEDLTKSDNEDITY 149 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 356 HSPGHAQLG 382 H PGHAQ+G Sbjct: 213 HLPGHAQMG 221 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 8.1 Identities = 22/66 (33%), Positives = 31/66 (46%) Frame = -2 Query: 204 LRVPLLPDTEKLHREESVFSHDHEVDEEASRGLDHSDLSVSHRDQPLVNEFISERVTRLS 25 L+ P D K R + HE D E SRG + D ++ L N+ I +T + Sbjct: 746 LKSPEWKDLAKKARSVNHLLTHHEYDYELSRG--YID------EKILENQNI---ITHMI 794 Query: 24 LHYVGS 7 L+YVGS Sbjct: 795 LNYVGS 800 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 265 SSLLATPHSSYLLSLCNGP 321 +SLL++ HS+ SL GP Sbjct: 696 ASLLSSTHSTLARSLMEGP 714 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,637 Number of Sequences: 438 Number of extensions: 4372 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -