BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060096.seq (627 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 47 1e-05 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 44 1e-04 SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 41 0.001 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 40 0.002 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 39 0.003 SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 36 0.020 SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) 36 0.027 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) 35 0.047 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 35 0.047 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 35 0.047 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 35 0.062 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) 35 0.062 SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.082 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) 33 0.14 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 33 0.14 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 33 0.14 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.19 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) 31 0.58 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 31 0.58 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.58 SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) 31 0.58 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.58 SB_56393| Best HMM Match : CTF_NFI (HMM E-Value=0.75) 31 0.77 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 31 0.77 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 30 1.3 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_9401| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 30 1.3 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 30 1.8 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 29 2.3 SB_27832| Best HMM Match : DUF1603 (HMM E-Value=5.3) 29 2.3 SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) 29 2.3 SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_43380| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_19711| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 28 7.1 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 28 7.1 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 28 7.1 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) 27 9.4 SB_24703| Best HMM Match : Disintegrin (HMM E-Value=0.8) 27 9.4 SB_16982| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/47 (44%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Frame = +1 Query: 142 KIFIGNLS-DKTTEADLRPLFEKYGTVVECDIVRNYGFVTWKTNKSA 279 +IFIGNL+ DK DL +F ++G V+ C + N+GFV ++T K A Sbjct: 47 RIFIGNLATDKIARQDLEEIFSRHGKVLGCSLHANFGFVQFETEKGA 93 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +3 Query: 348 SRKAPSTPTTKIFVGNL-TDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLD 500 ++ P + +IF+GNL TDK ++ E+F + G V+ C + N+GFV + Sbjct: 37 NKNDPHSVRCRIFIGNLATDKIARQDLEEIFSRHGKVLGCSLHANFGFVQFE 88 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 6/51 (11%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV------RNYGFVTWKTNKS 276 KIFIG L+ TTE L+ F ++GT+V+C I+ R +GFVT++++ S Sbjct: 51 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKRDGRSRGFGFVTYESSDS 101 Score = 35.1 bits (77), Expect = 0.047 Identities = 15/46 (32%), Positives = 27/46 (58%) Frame = +3 Query: 348 SRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYG 485 S+ + S KIF+G L T +++ F ++GT+V+C I++ G Sbjct: 41 SKMSESEKLRKIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKRDG 86 >SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +1 Query: 121 MPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVTWKTNKSAAKPFR 294 M GT ++F+G LS +T DL +F YG ++ CD+ YGF+ ++ + A + R Sbjct: 1 MASRGT-QLFVGRLSKETKLRDLENVFYLYGKLLRCDLKTAYGFIEYEDPRDAEEAMR 57 Score = 38.3 bits (85), Expect = 0.005 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = +3 Query: 375 TKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLD 500 T++FVG L+ +T+ ++ +F +G ++ CD+ YGF+ + Sbjct: 6 TQLFVGRLSKETKLRDLENVFYLYGKLLRCDLKTAYGFIEYE 47 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVTWKTNKSA 279 ++++G L TTE D+R F YG + + ++ NYGFV ++ ++ A Sbjct: 4 RVYLGRLPYGTTEDDVRRFFRSYGRLRDINLKNNYGFVEFEDDRDA 49 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +3 Query: 378 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVHLD 500 ++++G L T +VR F+ +G + + ++ NYGFV + Sbjct: 4 RVYLGRLPYGTTEDDVRRFFRSYGRLRDINLKNNYGFVEFE 44 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/42 (42%), Positives = 26/42 (61%) Frame = +1 Query: 124 PGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYG 249 PG T +F+GN+ TT DL+ FE+YG V++ DI + G Sbjct: 245 PGC-TRTLFVGNIEKTTTYGDLKEAFERYGEVIDVDIKKQPG 285 Score = 33.9 bits (74), Expect = 0.11 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +3 Query: 372 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYG 485 T +FVGN+ T +++E F+++G V++ DI + G Sbjct: 248 TRTLFVGNIEKTTTYGDLKEAFERYGEVIDVDIKKQPG 285 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 39.1 bits (87), Expect = 0.003 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 7/53 (13%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN-------YGFVTWKTNKSA 279 +IF+ + +TTE++LR FE+YG V E IVR+ Y F+T+++ + A Sbjct: 9 RIFVKGFNRETTESELRAFFEEYGVVKESKIVRDKHGVSKGYAFITFESQEVA 61 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 378 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 479 +IFV +T E+R F+++G V E IVR+ Sbjct: 9 RIFVKGFNRETTESELRAFFEEYGVVKESKIVRD 42 >SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 37.1 bits (82), Expect = 0.012 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 8/59 (13%) Frame = +1 Query: 133 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVTWKTNKSAAK 285 G +++ NLS T ADL+ F +YG VV IV N +G VT T++ AAK Sbjct: 347 GGKSLWVANLSSITRAADLKTRFSQYGKVVGAKIVTNSKAPGAQCFGLVTMTTSEEAAK 405 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 36.7 bits (81), Expect = 0.015 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +1 Query: 130 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGF 252 TG ++F+GNL D E +++ +F+KYG V E I + GF Sbjct: 50 TGRCRLFVGNLID-CDEEEMKEMFKKYGEVAEVFINKEKGF 89 Score = 35.9 bits (79), Expect = 0.027 Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +3 Query: 366 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI--VRNYGFVHLD 500 T ++FVGNL D E++E+F+K+G V E I + +GF+ LD Sbjct: 50 TGRCRLFVGNLIDCDEE-EMKEMFKKYGEVAEVFINKEKGFGFIRLD 95 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 36.3 bits (80), Expect = 0.020 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 130 TGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 243 + + K+F+G + E DLRP+FE YG + E I+++ Sbjct: 167 SNSVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKD 204 Score = 36.3 bits (80), Expect = 0.020 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 243 K+F+G +S E DLR +F +GT+ E ++RN Sbjct: 215 KLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRN 248 Score = 32.7 bits (71), Expect = 0.25 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +3 Query: 378 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 479 K+FVG ++ + ++R +F FGT+ E ++RN Sbjct: 215 KLFVGMISKHAKEEDLRVMFSPFGTIEELTVLRN 248 >SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) Length = 209 Score = 35.9 bits (79), Expect = 0.027 Identities = 11/33 (33%), Positives = 24/33 (72%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 243 +F+ L+ TT+ DL +F ++GT++ C+++R+ Sbjct: 122 LFVCKLNPVTTDEDLEIIFSRFGTILSCEVIRD 154 Score = 31.9 bits (69), Expect = 0.44 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +3 Query: 369 PTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 479 P +FV L T ++ +F +FGT++ C+++R+ Sbjct: 118 PDNVLFVCKLNPVTTDEDLEIIFSRFGTILSCEVIRD 154 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 243 +++GNL T +DL +FE+YG VV+ I+R+ Sbjct: 12 VYVGNLPYSLTNSDLHKVFERYGKVVKVTILRD 44 >SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) Length = 76 Score = 35.1 bits (77), Expect = 0.047 Identities = 15/47 (31%), Positives = 28/47 (59%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVTWKTNKSAAK 285 I++ N+ +E L+ +F KYG + + +R+YGFV + +SA + Sbjct: 4 IYVRNVPLPMSETQLKAVFTKYGQIEKVRKIRDYGFVYFAKRESAVQ 50 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +3 Query: 381 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYGFVH 494 I+V N+ +++ +F K+G + + +R+YGFV+ Sbjct: 4 IYVRNVPLPMSETQLKAVFTKYGQIEKVRKIRDYGFVY 41 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 35.1 bits (77), Expect = 0.047 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVE 225 ++FIGNL +AD+ +F KYGT++E Sbjct: 358 QVFIGNLPSGVKDADVNEVFSKYGTILE 385 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +3 Query: 348 SRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVE 461 +R AP + ++F+GNL + +V E+F K+GT++E Sbjct: 350 ARSAPDSH--QVFIGNLPSGVKDADVNEVFSKYGTILE 385 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 35.1 bits (77), Expect = 0.047 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDI 234 K+F+G LS +TT+ L+ F KYG +V DI Sbjct: 30 KLFVGGLSYETTKESLKEYFSKYGELVGVDI 60 Score = 34.3 bits (75), Expect = 0.082 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +3 Query: 306 ELVHGQ-AIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI 470 E V+G +++ K+R K+FVG L+ +T ++E F K+G +V DI Sbjct: 5 EAVNGYIGTSLDSNKTRMTKDDDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDI 60 Score = 29.1 bits (62), Expect = 3.1 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +3 Query: 339 AAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQK-FGTVVECDIVRNY 482 AA K P KIFVG L +T ++RE F K + V E + + + Sbjct: 91 AAPIGKPPHLRVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEH 139 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 34.7 bits (76), Expect = 0.062 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 6/82 (7%) Frame = +3 Query: 252 RHMENEQVGREAIQNLN------GELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTR 413 RH N V +A +N N GE + G I+++ A + KA + +F+GNL Sbjct: 10 RHTLNGYVVYKAAENANQAIASNGEEIDGFHIRVDLASNDKAHDHQRS-VFIGNLPFDIE 68 Query: 414 APEVRELFQKFGTVVECDIVRN 479 +RELF G V ++R+ Sbjct: 69 EEPLRELFTTCGNVESVRLIRD 90 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 34.7 bits (76), Expect = 0.062 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDI---VRNYGFVTW 261 K+F+G L + TTE L F ++G V + I R++GFVT+ Sbjct: 200 KLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPKPFRHFGFVTF 242 Score = 32.7 bits (71), Expect = 0.25 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 3/63 (4%) Frame = +3 Query: 312 VHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI---VRNY 482 + G+ ++ + ++ + P K+FVG L + T + E F +FG V + I R++ Sbjct: 179 IQGRLCEVRLPRPKEELNVPK-KLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPKPFRHF 237 Query: 483 GFV 491 GFV Sbjct: 238 GFV 240 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/63 (23%), Positives = 32/63 (50%), Gaps = 8/63 (12%) Frame = +1 Query: 115 SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDI--------VRNYGFVTWKTN 270 +K+ G + + L TTE++++ F ++G + C++ R +GFV +K + Sbjct: 107 TKVEGVDVGDLIVLGLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKD 166 Query: 271 KSA 279 + A Sbjct: 167 EDA 169 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 34.7 bits (76), Expect = 0.062 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 8/52 (15%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYG----TVVECDIV----RNYGFVTWKTNK 273 K+F+G L+ +TT LR FE YG VV CD R +G+VT+ K Sbjct: 15 KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYK 66 >SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) Length = 694 Score = 34.7 bits (76), Expect = 0.062 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 160 LSDKTTEADLRPLFEKYGTVVECDIVRNY 246 LS TTE DLRP+FEKYG V IV ++ Sbjct: 188 LSLYTTERDLRPVFEKYGPVEAIQIVYDH 216 >SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.3 bits (75), Expect = 0.082 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 378 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIV 473 K+FVGN+ K RA E+++ F FG VV I+ Sbjct: 80 KVFVGNIGFKVRARELKDFFGYFGDVVYAQII 111 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 237 K+F+GN+ K +L+ F +G VV I+ Sbjct: 80 KVFVGNIGFKVRARELKDFFGYFGDVVYAQII 111 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 33.9 bits (74), Expect = 0.11 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +1 Query: 136 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVR 240 T +F+GNL + DLR FEK+G V++ DI R Sbjct: 236 TRTLFVGNLETGISCQDLRLSFEKFGVVLDVDIKR 270 Score = 32.7 bits (71), Expect = 0.25 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 372 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVR 476 T +FVGNL ++R F+KFG V++ DI R Sbjct: 236 TRTLFVGNLETGISCQDLRLSFEKFGVVLDVDIKR 270 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +3 Query: 312 VHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECD 467 + GQ I K S TT+++VG L PE+ F +FG + D Sbjct: 297 MQGQCIGRNHIKIGYGRSQQTTRLWVGGLGPWISIPELEREFDRFGAIRRID 348 >SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) Length = 201 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = +1 Query: 136 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN---YGFVTWKTNKSAAKPFRIL 300 T K+++GNL ++L FEK+G + + + RN + FV ++ + A + R L Sbjct: 3 TTKLYVGNLGRNADSSELERAFEKFGRLSKVWVARNPPGFAFVEYEDYRDAEEAVREL 60 Score = 33.1 bits (72), Expect = 0.19 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 372 TTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 479 TTK++VGNL + E+ F+KFG + + + RN Sbjct: 3 TTKLYVGNLGRNADSSELERAFEKFGRLSKVWVARN 38 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 33.5 bits (73), Expect = 0.14 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYG 249 ++++GNL E DL +F KYG + + D+ G Sbjct: 262 RVYVGNLPQDVREKDLHDIFYKYGHIADVDLKNRRG 297 Score = 31.1 bits (67), Expect = 0.77 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +3 Query: 378 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRNYG 485 +++VGNL R ++ ++F K+G + + D+ G Sbjct: 262 RVYVGNLPQDVREKDLHDIFYKYGHIADVDLKNRRG 297 >SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) Length = 672 Score = 33.5 bits (73), Expect = 0.14 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 8/60 (13%) Frame = +1 Query: 139 FKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVTWKTNKSAAKPFR 294 F+IF G+L + T+ L F KY + ++ IVR+ YGFV++K K R Sbjct: 217 FRIFCGDLGSEVTDESLTRAFAKYTSFLKAKIVRDKKSNKSKGYGFVSFKDPNDFIKAMR 276 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 33.1 bits (72), Expect = 0.19 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 7/47 (14%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV-------RNYGFVTWK 264 +F+G L+ T E L+ FE++G V I+ RNYGFV +K Sbjct: 82 VFVGGLASGTDEEGLKDYFEQFGEVESVRIMRTFLGYSRNYGFVLFK 128 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 109 P*SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV 237 P + G +F+ NLS+ T E D+ F YG V + I+ Sbjct: 309 PNEEKQGVRERTLFVDNLSEDTKELDVLRYFRPYGQVAKVHIL 351 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 7/44 (15%) Frame = +3 Query: 381 IFVGNLTDKTRAPEVRELFQKFGTVVECDIV-------RNYGFV 491 +FVG L T +++ F++FG V I+ RNYGFV Sbjct: 82 VFVGGLASGTDEEGLKDYFEQFGEVESVRIMRTFLGYSRNYGFV 125 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 32.3 bits (70), Expect = 0.33 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 243 +++ N+ + EA+ R FE YG +V C ++R+ Sbjct: 135 LYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRD 167 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 31.9 bits (69), Expect = 0.44 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTV 219 K+FIG L+ TTE DL+ F YG V Sbjct: 203 KVFIGGLAFGTTEEDLKEYFSTYGMV 228 >SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 31.5 bits (68), Expect = 0.58 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +1 Query: 124 PGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVTWKTNKS 276 PG +FI +L + T+ADL F+ +GTV+ + F+ +TN S Sbjct: 224 PGPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKV-----FIDKQTNMS 269 >SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) Length = 362 Score = 31.5 bits (68), Expect = 0.58 Identities = 17/51 (33%), Positives = 27/51 (52%) Frame = +1 Query: 124 PGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVTWKTNKS 276 PG +FI +L + T+ADL F+ +GTV+ + F+ +TN S Sbjct: 272 PGPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKV-----FIDKQTNMS 317 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 31.5 bits (68), Expect = 0.58 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +3 Query: 345 KSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDI 470 + +++P+ TK++V +LT V+E+F +G V D+ Sbjct: 1147 RRKRSPTPKPTKLYVAHLTRNVNKDHVQEIFSVYGRVKTVDL 1188 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 31.5 bits (68), Expect = 0.58 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 8/59 (13%) Frame = +1 Query: 133 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVTWKTNKSAAK 285 G ++++G+L TEA ++ +FE +GTV ++ + YGFV ++ ++A + Sbjct: 240 GPTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKR 298 >SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) Length = 419 Score = 31.5 bits (68), Expect = 0.58 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 13/68 (19%) Frame = +1 Query: 121 MPGTGTFKI-----FIGNLSDKTTEADLRPLFEKYGTVV--------ECDIVRNYGFVTW 261 +P TG K+ +I L TT+ DL L KYGT++ + ++ + YGFV + Sbjct: 89 LPDTGEEKLSKTNLYIRGLKANTTDDDLVRLCHKYGTIISTKAILDKDTNLCKGYGFVDF 148 Query: 262 KTNKSAAK 285 ++ SA K Sbjct: 149 ESPISAQK 156 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 31.5 bits (68), Expect = 0.58 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 8/53 (15%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVTWKTNKS 276 K +IGNL K EADL+ F +Y VV+ ++ R + FVT+ + K+ Sbjct: 231 KCYIGNLDFKVNEADLQDRFSRY-DVVDVQVISDRETQRPRGFAFVTFGSKKN 282 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 509 DVNDAIKELNGMMVDGQPMKVQLSTSRVRXAAG 607 ++ DAI EL+G DG+ MKV + SR + G Sbjct: 282 NMEDAINELDGQEFDGRSMKVNQARSREQRGGG 314 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 31.5 bits (68), Expect = 0.58 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 8/54 (14%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVTWKTNKSA 279 +I+I ++ E D++ +FE +G VV C + + YGF+ ++ +SA Sbjct: 200 RIYIASVHPDLLEDDIKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSA 253 >SB_56393| Best HMM Match : CTF_NFI (HMM E-Value=0.75) Length = 886 Score = 31.1 bits (67), Expect = 0.77 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 154 GNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVTWKTNKSAAKP 288 G+ + K E L+PL + Y + V C++ + + K NK + KP Sbjct: 131 GSFTSKPLEGKLKPLMDNYKSPVNCEMFYD-DMINAKKNKESLKP 174 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 31.1 bits (67), Expect = 0.77 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 124 PGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECD 231 P + + + NLS +T+ DL+ F KYG V D Sbjct: 793 PVRTNYSVIVENLSSRTSWQDLKDYFRKYGKVTYAD 828 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 30.7 bits (66), Expect = 1.0 Identities = 17/49 (34%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--RNYGFVTWKTNKSAAK 285 +++G L K TE DLR F ++G + +V +N FV + T+++AA+ Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFGELRSISMVPRQNCAFVCF-TSRAAAE 353 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 30.7 bits (66), Expect = 1.0 Identities = 9/36 (25%), Positives = 23/36 (63%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGF 252 +++GNL + +L+ +F +YG+++E + + G+ Sbjct: 617 VYVGNLPPDVKDYELQQMFSQYGSILETKVFADKGY 652 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +3 Query: 345 KSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 479 ++R P ++VGNL K + +F K VV C ++ + Sbjct: 359 RARYFPEEENRSLYVGNLDPKCTQELICSIFNKIAKVVRCKMINS 403 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 6/51 (11%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN------YGFVTWKTNKSA 279 +++GNL K T+ + +F K VV C ++ + Y FV ++T+ A Sbjct: 371 LYVGNLDPKCTQELICSIFNKIAKVVRCKMINSPTDKGPYCFVEFETHADA 421 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 8/60 (13%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVTWKTNKSAAKPFRIL 300 +F+GN+ + +E L+ +F + G V+ +V + YGF +K ++A R L Sbjct: 27 VFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPKGYGFCEYKDQETALSAMRNL 86 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +1 Query: 109 P*SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYG 249 P +P +F+GNLS E L FE+ G C ++ G Sbjct: 170 PKKTVPAKEEMSVFLGNLSFDADEETLAAFFEEKGLSATCRVITQEG 216 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVTWKTNKSAAK 285 +++ NLS TE L+ + +YG V +++Y FV + A K Sbjct: 331 VYLRNLSPSITEEKLKEEYSQYGAVDRVKKLKDYAFVHFTERDHALK 377 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +1 Query: 118 KMPGTGTFKI----FIGNLSDKTTEADLRPLFEKYGTVVE 225 K PGTG+ K+ FIG + E +L P+FE+ G + + Sbjct: 141 KPPGTGSEKVCSQVFIGKVPRDCFEDELIPVFEECGHIYD 180 >SB_9401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +2 Query: 80 IYCYSLYIVTHNLKCRAPVLSKSSSGTFLIKPQKPILDRYSKNTVRS*NAISSEITVS 253 IYC S + V + APVL K + T +I+P P+ ++ N AI E+ +S Sbjct: 186 IYCASKFAVEGYAEAMAPVLGKFNIKTTIIEP-GPVATNFASNA----KAIRDEVDIS 238 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 30.3 bits (65), Expect = 1.3 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 10/65 (15%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVTWKTNKSA--AKPFR 294 +F+GNL + TE L YG + +VR+ YGFV + T ++A AK Sbjct: 115 LFVGNLPFEFTETQFGDLMSPYGNIERLFLVRSEVTGDSKGYGFVEYATRENAMQAKQQL 174 Query: 295 ILTAS 309 + TAS Sbjct: 175 LNTAS 179 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 509 DVNDAIKELNGMMVDGQPMKVQLSTSRVRXAAG 607 D A+K LNG V G+ +K+ S SR R G Sbjct: 111 DAQTAVKSLNGKEVQGRTLKIAPSISRGRDGGG 143 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 366 TPTTKIFVGNLTDKTRAPEVRELFQKFGTV 455 T T KIF+G L+ T ++++ F +FG V Sbjct: 180 TTTKKIFIGGLSTNTSEEDMKKYFSQFGKV 209 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 243 K++IGNL+ + E ++ FE++G V + DI+R+ Sbjct: 10 KLYIGNLNFNSDEGEIEQAFEEFG-VEKVDILRD 42 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +3 Query: 378 KIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 479 K+++GNL + E+ + F++FG V + DI+R+ Sbjct: 10 KLYIGNLNFNSDEGEIEQAFEEFG-VEKVDILRD 42 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV 237 +FI NLS +T+ ++ LF+++G + C +V Sbjct: 418 VFIRNLSFDSTQKNITNLFKQFGDIAYCKVV 448 Score = 28.3 bits (60), Expect = 5.4 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 9/66 (13%) Frame = +1 Query: 115 SKMPGTGTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIV---------RNYGFVTWKT 267 SK P IF+ NL T+A+ + FE+ G + IV R +G+VT+ Sbjct: 12 SKTPVISKTTIFVRNLPYNITDAEFKSAFEEIGPLKRGFIVKDKDNQNRCRGFGYVTFAL 71 Query: 268 NKSAAK 285 + A K Sbjct: 72 EEDALK 77 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 29.5 bits (63), Expect = 2.3 Identities = 14/59 (23%), Positives = 29/59 (49%) Frame = +3 Query: 285 AIQNLNGELVHGQAIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVE 461 AI+ +N V+G+ I++ A + +F+GNL + + + F FG +++ Sbjct: 70 AIKVMNMIKVYGKPIRVNKASAHNKNLDVGANLFIGNLDTEVDEKLLYDTFSAFGVILQ 128 >SB_27832| Best HMM Match : DUF1603 (HMM E-Value=5.3) Length = 215 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -2 Query: 284 FAADLFVFHVTKP*FLTISHSTTVPYFSNSGLRSASVVLSERF 156 FA F F +TK FL ++T + Y + + SAS +LS F Sbjct: 94 FAGKYFNFTITKEFFLRKKNATLITYIVFAFISSASCILSNVF 136 >SB_33046| Best HMM Match : RRM_1 (HMM E-Value=3.6e-13) Length = 1463 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/31 (32%), Positives = 22/31 (70%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIV 237 I++G+L+ T+ L+ +FE++GT+ D++ Sbjct: 543 IWVGHLAKIVTQDTLQGIFEEHGTITSIDLI 573 >SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 381 IFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 479 +FV NL + E+ ELF K G V + +V N Sbjct: 173 LFVSNLPFDAKESEIEELFSKHGVVKQVRLVTN 205 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +3 Query: 324 AIKIEAAKSRKAPSTPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 479 ++ + S P +P KIF+G L + +V+EL FG + ++V++ Sbjct: 657 SVHVPGVVSTVVPDSPH-KIFIGGLPNYLNEDQVKELLSSFGELRAFNLVKD 707 >SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRNYGFVTWKTNKSA 279 +++ G L E DL YG V E + YGFV + + A Sbjct: 6 RVYFGRLPRDCRERDLEKFVRGYGRVREISMKLGYGFVEFDDYRDA 51 >SB_43380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = +1 Query: 13 VRHVYCVGNSWSLFGVHIFNLCYILLFFVHSNP*SKMPGTG 135 + H+ W + +H+ N Y+L F S P ++ +G Sbjct: 202 IHHLGYKATFWGILSLHLINFIYLLFFLPESMPKQRIEQSG 242 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +1 Query: 133 GTFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 243 G + + NL+ +TT DL+ +F+KYG + + I R+ Sbjct: 14 GMTSLKVDNLTYRTTVEDLKQVFKKYGDLGDIYIPRD 50 >SB_19711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN 243 + I NL E DL+ L + YG V+ C+I R+ Sbjct: 121 LIIQNLPKGIQEKDLKELLQLYGNVLVCNIERD 153 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDI 234 K+F+G L++ TTE +R F+ + E D+ Sbjct: 9 KLFVGGLNEDTTEETVRAYFKSFCEGSEADV 39 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 509 DVNDAIKELNGMMVDGQPMKVQLSTSRVRXAAG 607 ++ AI E +G DG+PMKV + R AG Sbjct: 57 EMEKAIDEFDGQDFDGRPMKVNQAQPRGERGAG 89 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +3 Query: 366 TPTTKIFVGNLTDKTRAPEVRELFQKFGTVVECDIVRN 479 T TK+FVG + ++ +R+ F +FG + E ++++ Sbjct: 7 TKFTKLFVGGIPYESGDDALRKFFAQFGEIREAVVIKD 44 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 27.9 bits (59), Expect = 7.1 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 8/62 (12%) Frame = +1 Query: 142 KIFIGNLSDKTTEADLRPLFEKYGTVVECDIV--------RNYGFVTWKTNKSAAKPFRI 297 + +IGNLS E L F VV+ ++ R +GFVT + K+ KP + Sbjct: 83 RCYIGNLSYSVDEQALEEKFHDCN-VVDVRVITDRETGRPRGFGFVTLEAKKTRIKPLKN 141 Query: 298 LT 303 LT Sbjct: 142 LT 143 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 27.9 bits (59), Expect = 7.1 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 145 IFIGNLSDKTTEADLRPLFEKYGTV--VECDIVRNYGFVTWKTNKSA 279 IF+ L + T L LF YG + +E + + YGFV + A Sbjct: 274 IFVYGLPQEATPLFLYKLFSPYGAITNIELKLDKGYGFVNMSNYEEA 320 >SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) Length = 304 Score = 27.5 bits (58), Expect = 9.4 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 8/64 (12%) Frame = +1 Query: 136 TFKIFIGNLSDKTTEADLRPLFEKYGTVVECDIVRN--------YGFVTWKTNKSAAKPF 291 T I + NLS++T E+DL+ LF G + + ++ + F+ + + AA+ Sbjct: 180 TATIRVTNLSEETRESDLQELFRPLGPISRIFLAKDKFTNQSKGFAFINFVHREDAARAI 239 Query: 292 RILT 303 +L+ Sbjct: 240 EVLS 243 >SB_24703| Best HMM Match : Disintegrin (HMM E-Value=0.8) Length = 640 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 Query: 327 SPAHELTRR*DSEWLRGRLVRFPCDETVISDDIA 226 SP H R+ SE+ G+L DE VI D A Sbjct: 272 SPQHVFIRKRQSEYFEGKLDNVGPDEAVIQVDFA 305 >SB_16982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1031 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/69 (26%), Positives = 29/69 (42%), Gaps = 3/69 (4%) Frame = -2 Query: 308 LAVKILNGFAADLFVFHVTKP*FLTISHSTTVPYFSNSGLRSASVVLSE---RFPMKILK 138 L VK+LN F+ H + L++ +V+ SE RFP K Sbjct: 415 LTVKLLNFVLQSKFISHHLSSYLNAQCDENEINDNGLEALQNIAVLFSELLSRFPSSYAK 474 Query: 137 VPVPGILDY 111 +P+P + +Y Sbjct: 475 LPIPALKEY 483 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,585,007 Number of Sequences: 59808 Number of extensions: 358803 Number of successful extensions: 1035 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 890 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1035 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -