BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060096.seq (627 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 4.3 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 21 7.4 AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding prote... 21 7.4 AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding prote... 21 7.4 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 21 9.8 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 524 IKELNGMMVDGQPMKVQLSTSR 589 ++ LNG+ G+P +QL + R Sbjct: 315 LRGLNGLEFAGRPQNLQLQSQR 336 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +2 Query: 95 LYIVTHNLKCRAPVLSKSSSGTFLIK 172 ++I TH L C+ + K+ S +L++ Sbjct: 34 MHIRTHTLPCKCHLCGKAFSRPWLLQ 59 >AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 53 LVFIFLTCVIYCYSLYIVTHNLKC 124 + + L CVIYC ++ T + C Sbjct: 3 ITIVSLLCVIYCALVHADTVAILC 26 >AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +2 Query: 53 LVFIFLTCVIYCYSLYIVTHNLKC 124 + + L CVIYC ++ T + C Sbjct: 3 ITIVSLLCVIYCALVHADTVAILC 26 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/36 (22%), Positives = 19/36 (52%) Frame = +2 Query: 83 YCYSLYIVTHNLKCRAPVLSKSSSGTFLIKPQKPIL 190 YCY+L + +C A + ++ ++L + + +L Sbjct: 220 YCYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLL 255 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,070 Number of Sequences: 438 Number of extensions: 2980 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -