BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= NV060094.seq
(677 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. 24 5.1
AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 23 6.7
>Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein.
Length = 115
Score = 23.8 bits (49), Expect = 5.1
Identities = 10/33 (30%), Positives = 19/33 (57%)
Frame = +2
Query: 572 DIAKCADLVLLLCDASFGFEMEIFEFLNICQVH 670
D+ + V+ L +AS + + +FE N+C +H
Sbjct: 80 DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIH 112
>AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase
inhibitor protein protein.
Length = 335
Score = 23.4 bits (48), Expect = 6.7
Identities = 8/11 (72%), Positives = 9/11 (81%)
Frame = +2
Query: 53 SKTCLIFCYKC 85
SK+CL F YKC
Sbjct: 182 SKSCLSFAYKC 192
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 621,552
Number of Sequences: 2352
Number of extensions: 11586
Number of successful extensions: 19
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68159265
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -