Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060094.seq
         (677 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y09952-1|CAA71083.1|  115|Anopheles gambiae histone H3 protein.        24   5.1  
AY928182-1|AAX22219.1|  335|Anopheles gambiae phenoloxidase inhi...    23   6.7  

>Y09952-1|CAA71083.1|  115|Anopheles gambiae histone H3 protein.
          Length = 115

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 10/33 (30%), Positives = 19/33 (57%)
 Frame = +2

Query: 572 DIAKCADLVLLLCDASFGFEMEIFEFLNICQVH 670
           D+   +  V+ L +AS  + + +FE  N+C +H
Sbjct: 80  DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIH 112


>AY928182-1|AAX22219.1|  335|Anopheles gambiae phenoloxidase
           inhibitor protein protein.
          Length = 335

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +2

Query: 53  SKTCLIFCYKC 85
           SK+CL F YKC
Sbjct: 182 SKSCLSFAYKC 192


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 621,552
Number of Sequences: 2352
Number of extensions: 11586
Number of successful extensions: 19
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68159265
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)