BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060094.seq (677 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 24 1.5 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 23 2.0 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 6.2 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 21 8.2 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 8.2 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 8.2 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = -3 Query: 660 HMFKNSNISISKPKLASHRSSTRSAHL 580 H+F+++NIS+ +P L + + + A L Sbjct: 234 HLFESANISLDEPPLGKNLNLSLHASL 260 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -1 Query: 605 GAALDQRIWLCLSLNLHHYCILSTLSCAF*T*HSNGTV 492 G L R+ + + CIL +++CA H+ G V Sbjct: 140 GTTLQNRLDEAILIKNERICILKSITCALQFCHNAGIV 177 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.8 bits (44), Expect = 6.2 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 201 SAFCMMRFFLIENCFVCHFCWYFYLHLRIPIL 106 +A C M++ LIE+ F +F L + I I+ Sbjct: 208 TARCSMKWTLIEHAFEISTMLFFVLPMTIIIV 239 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -2 Query: 235 YSCSSSSRLYAQRVLHDAIFSYR 167 YSC + S L + H ++ YR Sbjct: 24 YSCVNKSMLNSHLKSHSNVYQYR 46 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 8.2 Identities = 11/31 (35%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = -3 Query: 207 TPSAFCMMRFFLIENCFVCHFC--WYFYLHL 121 TPS + CFVC W YLH+ Sbjct: 400 TPSDIDKYSRIVFPVCFVCFNLMYWIIYLHI 430 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 8.2 Identities = 11/31 (35%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = -3 Query: 207 TPSAFCMMRFFLIENCFVCHFC--WYFYLHL 121 TPS + CFVC W YLH+ Sbjct: 400 TPSDIDKYSRIVFPVCFVCFNLMYWIIYLHI 430 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,314 Number of Sequences: 438 Number of extensions: 2974 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -