BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060090.seq (683 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 75 2e-15 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 27 0.73 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 27 0.73 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 26 0.96 EF588665-1|ABQ96851.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588664-1|ABQ96850.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588663-1|ABQ96849.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588662-1|ABQ96848.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588661-1|ABQ96847.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588660-1|ABQ96846.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588659-1|ABQ96845.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588658-1|ABQ96844.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588657-1|ABQ96843.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588656-1|ABQ96842.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588655-1|ABQ96841.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588654-1|ABQ96840.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588651-1|ABQ96838.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588650-1|ABQ96837.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588649-1|ABQ96836.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588647-1|ABQ96835.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588646-1|ABQ96834.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588642-1|ABQ96832.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588641-1|ABQ96831.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588640-1|ABQ96830.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588639-1|ABQ96829.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588638-1|ABQ96828.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588637-1|ABQ96827.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588636-1|ABQ96826.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588635-1|ABQ96825.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588634-1|ABQ96824.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588633-1|ABQ96823.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588632-1|ABQ96822.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588631-1|ABQ96821.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588630-1|ABQ96820.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588629-1|ABQ96819.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588628-1|ABQ96818.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588627-1|ABQ96817.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588626-1|ABQ96816.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588625-1|ABQ96815.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588624-1|ABQ96814.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588623-1|ABQ96813.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588622-1|ABQ96812.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588621-1|ABQ96811.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588620-1|ABQ96810.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588618-1|ABQ96809.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588617-1|ABQ96808.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588616-1|ABQ96807.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588615-1|ABQ96806.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588614-1|ABQ96805.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588612-1|ABQ96803.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588611-1|ABQ96802.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588610-1|ABQ96801.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588609-1|ABQ96800.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588608-1|ABQ96799.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588607-1|ABQ96798.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588606-1|ABQ96797.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588605-1|ABQ96796.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588604-1|ABQ96795.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588603-1|ABQ96794.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588602-1|ABQ96793.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588601-1|ABQ96792.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588600-1|ABQ96791.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588599-1|ABQ96790.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588598-1|ABQ96789.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588597-1|ABQ96788.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588596-1|ABQ96787.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588595-1|ABQ96786.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588591-1|ABQ96785.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588590-1|ABQ96784.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588589-1|ABQ96783.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588588-1|ABQ96782.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588587-1|ABQ96781.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588586-1|ABQ96780.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588585-1|ABQ96779.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588584-1|ABQ96778.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588583-1|ABQ96777.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588582-1|ABQ96776.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588581-1|ABQ96775.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588580-1|ABQ96774.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588579-1|ABQ96773.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588577-1|ABQ96772.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588576-1|ABQ96771.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588574-1|ABQ96770.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588571-1|ABQ96769.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588570-1|ABQ96768.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588569-1|ABQ96767.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588568-1|ABQ96766.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588567-1|ABQ96765.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588566-1|ABQ96764.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588565-1|ABQ96763.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588564-1|ABQ96762.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588563-1|ABQ96761.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588562-1|ABQ96760.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588561-1|ABQ96759.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588560-1|ABQ96758.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588559-1|ABQ96757.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588558-1|ABQ96756.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588557-1|ABQ96755.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588556-1|ABQ96754.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588555-1|ABQ96753.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588554-1|ABQ96752.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588553-1|ABQ96751.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588551-1|ABQ63507.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588550-1|ABQ63506.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588549-1|ABQ63505.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588548-1|ABQ63504.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588547-1|ABQ63503.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588546-1|ABQ63502.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588545-1|ABQ63501.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588544-1|ABQ63500.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588543-1|ABQ63499.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588542-1|ABQ63498.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588541-1|ABQ63497.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588540-1|ABQ63496.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588539-1|ABQ63495.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588538-1|ABQ63494.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588537-1|ABQ63493.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588536-1|ABQ63492.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588535-1|ABQ63491.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588534-1|ABQ63490.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588533-1|ABQ63489.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588532-1|ABQ63488.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588531-1|ABQ63487.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588530-1|ABQ63486.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588529-1|ABQ63485.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588528-1|ABQ63484.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588527-1|ABQ63483.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588526-1|ABQ63482.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588525-1|ABQ63481.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588524-1|ABQ63480.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588523-1|ABQ63479.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588522-1|ABQ63478.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588521-1|ABQ63477.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588520-1|ABQ63476.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588519-1|ABQ63475.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588518-1|ABQ96750.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588517-1|ABQ96749.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588516-1|ABQ96748.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588515-1|ABQ96747.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588514-1|ABQ96746.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588512-1|ABQ96745.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588509-1|ABQ96744.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588508-1|ABQ96743.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588507-1|ABQ96742.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588506-1|ABQ96741.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588505-1|ABQ96740.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588504-1|ABQ96739.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588503-1|ABQ96738.1| 169|Anopheles gambiae transposase protein. 25 2.9 EF588502-1|ABQ96737.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588501-1|ABQ96736.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588500-1|ABQ96735.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588499-1|ABQ96734.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588498-1|ABQ96733.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588497-1|ABQ96732.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588496-1|ABQ96731.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588494-1|ABQ96730.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588493-1|ABQ96729.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588492-1|ABQ96728.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588491-1|ABQ96727.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588490-1|ABQ96726.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588489-1|ABQ96725.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588488-1|ABQ96724.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588487-1|ABQ96723.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588486-1|ABQ96722.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588485-1|ABQ96721.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588484-1|ABQ96720.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588483-1|ABQ96719.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588482-1|ABQ96718.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588481-1|ABQ96717.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588480-1|ABQ96716.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588479-1|ABQ96715.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588478-1|ABQ96714.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588477-1|ABQ96713.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588476-1|ABQ96712.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588475-1|ABQ96711.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588474-1|ABQ96710.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588473-1|ABQ96709.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588472-1|ABQ96708.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588471-1|ABQ96707.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588470-1|ABQ96706.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588469-1|ABQ96705.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588468-1|ABQ96704.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588467-1|ABQ96703.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588466-1|ABQ96702.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588465-1|ABQ96701.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588464-1|ABQ96700.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588463-1|ABQ96699.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588462-1|ABQ96698.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588461-1|ABQ96697.1| 176|Anopheles gambiae transposase protein. 25 2.9 EF588459-1|ABQ96695.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588458-1|ABQ96694.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588457-1|ABQ96693.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588456-1|ABQ96692.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588455-1|ABQ96691.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588454-1|ABQ96690.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588453-1|ABQ96689.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588452-1|ABQ96688.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588451-1|ABQ96687.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588450-1|ABQ96686.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588449-1|ABQ96685.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588448-1|ABQ96684.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588447-1|ABQ96683.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588446-1|ABQ96682.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588445-1|ABQ96681.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588444-1|ABQ96680.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588443-1|ABQ96679.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588442-1|ABQ96678.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588441-1|ABQ96677.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588440-1|ABQ96676.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588439-1|ABQ96675.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588438-1|ABQ96674.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588437-1|ABQ96673.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588436-1|ABQ96672.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588435-1|ABQ96671.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588434-1|ABQ96670.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588433-1|ABQ96669.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588432-1|ABQ96668.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588431-1|ABQ96667.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588430-1|ABQ96666.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588429-1|ABQ96665.1| 177|Anopheles gambiae transposase protein. 25 2.9 EF588428-1|ABQ96664.1| 177|Anopheles gambiae transposase protein. 25 2.9 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 25 2.9 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 2.9 EF588653-1|ABQ96839.1| 176|Anopheles gambiae transposase protein. 24 3.9 EF588460-1|ABQ96696.1| 177|Anopheles gambiae transposase protein. 24 3.9 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 23 9.0 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 74.9 bits (176), Expect = 2e-15 Identities = 31/77 (40%), Positives = 50/77 (64%) Frame = +2 Query: 263 FGHTSYVRNTCVFGGAPKREQARDLERGVEIVIATPGRLIDFLEKGTTNLQRCTYLVLDE 442 F H + ++ +GG + Q + + G +++ATPGRL+DF+++G + ++VLDE Sbjct: 272 FAHGTKLKVCVSYGGTAVQHQLQLMRGGCHVLVATPGRLLDFIDRGYVTFENVNFVVLDE 331 Query: 443 ADRMLDMGFEPQIRKII 493 ADRMLDMGF P I K++ Sbjct: 332 ADRMLDMGFLPSIEKVM 348 Score = 40.3 bits (90), Expect = 6e-05 Identities = 21/44 (47%), Positives = 30/44 (68%), Gaps = 2/44 (4%) Frame = +3 Query: 111 QTGSGKTLAYILPAIVH-INNQPPIR-RGDGPIALVLAPTRELA 236 QTGSGKT A++LP I H ++ + + R P +++APTRELA Sbjct: 219 QTGSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELA 262 Score = 37.5 bits (83), Expect = 4e-04 Identities = 16/31 (51%), Positives = 25/31 (80%) Frame = +1 Query: 511 RQTLMWSATWPKEVKKLAEDYLGDYIQINIG 603 RQTLM+SAT+P E+++LA +L +YI + +G Sbjct: 359 RQTLMFSATFPAEIQELAGKFLHNYICVFVG 389 Score = 33.9 bits (74), Expect = 0.005 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 1 RHEVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 102 R EV V+ Y +PTPIQ PI ++G++L+ Sbjct: 182 REEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLM 215 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 26.6 bits (56), Expect = 0.73 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 484 KNH*ANTPNRQTLMWSATWPKEVKKLAEDYLGDY 585 KNH PNR+ ++W A ++++ E YLG + Sbjct: 553 KNH-LYMPNRERVLWPAHNVRDLRLWTEVYLGSW 585 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 26.6 bits (56), Expect = 0.73 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 484 KNH*ANTPNRQTLMWSATWPKEVKKLAEDYLGDY 585 KNH PNR+ ++W A ++++ E YLG + Sbjct: 553 KNH-LYMPNRERVLWPAHNVRDLRLWTEVYLGSW 585 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 26.2 bits (55), Expect = 0.96 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = +3 Query: 87 WKEFSWRTQTGSGKTLAYILPAIVHINNQPPIRRGDG 197 +K +++ Q + ++ I A+V + Q +RR DG Sbjct: 456 YKTLNYKAQKAAARSHVKIFKALVRLRKQRTLRRNDG 492 >EF588665-1|ABQ96851.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588664-1|ABQ96850.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588663-1|ABQ96849.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588662-1|ABQ96848.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588661-1|ABQ96847.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588660-1|ABQ96846.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588659-1|ABQ96845.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588658-1|ABQ96844.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588657-1|ABQ96843.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588656-1|ABQ96842.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588655-1|ABQ96841.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588654-1|ABQ96840.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588651-1|ABQ96838.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588650-1|ABQ96837.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588649-1|ABQ96836.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588647-1|ABQ96835.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588646-1|ABQ96834.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588642-1|ABQ96832.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588641-1|ABQ96831.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588640-1|ABQ96830.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588639-1|ABQ96829.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588638-1|ABQ96828.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588637-1|ABQ96827.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588636-1|ABQ96826.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588635-1|ABQ96825.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588634-1|ABQ96824.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588633-1|ABQ96823.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588632-1|ABQ96822.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588631-1|ABQ96821.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588630-1|ABQ96820.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588629-1|ABQ96819.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588628-1|ABQ96818.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588627-1|ABQ96817.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588626-1|ABQ96816.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588625-1|ABQ96815.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588624-1|ABQ96814.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588623-1|ABQ96813.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588622-1|ABQ96812.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588621-1|ABQ96811.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588620-1|ABQ96810.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588618-1|ABQ96809.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588617-1|ABQ96808.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588616-1|ABQ96807.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588615-1|ABQ96806.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588614-1|ABQ96805.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588612-1|ABQ96803.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588611-1|ABQ96802.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588610-1|ABQ96801.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588609-1|ABQ96800.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588608-1|ABQ96799.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588607-1|ABQ96798.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588606-1|ABQ96797.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588605-1|ABQ96796.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588604-1|ABQ96795.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588603-1|ABQ96794.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588602-1|ABQ96793.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588601-1|ABQ96792.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588600-1|ABQ96791.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588599-1|ABQ96790.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588598-1|ABQ96789.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588597-1|ABQ96788.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588596-1|ABQ96787.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588595-1|ABQ96786.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588591-1|ABQ96785.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588590-1|ABQ96784.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588589-1|ABQ96783.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588588-1|ABQ96782.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588587-1|ABQ96781.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588586-1|ABQ96780.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588585-1|ABQ96779.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588584-1|ABQ96778.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588583-1|ABQ96777.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588582-1|ABQ96776.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588581-1|ABQ96775.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588580-1|ABQ96774.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588579-1|ABQ96773.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588577-1|ABQ96772.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588576-1|ABQ96771.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588574-1|ABQ96770.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588571-1|ABQ96769.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588570-1|ABQ96768.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588569-1|ABQ96767.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588568-1|ABQ96766.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588567-1|ABQ96765.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588566-1|ABQ96764.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588565-1|ABQ96763.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588564-1|ABQ96762.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588563-1|ABQ96761.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588562-1|ABQ96760.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588561-1|ABQ96759.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588560-1|ABQ96758.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588559-1|ABQ96757.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588558-1|ABQ96756.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588557-1|ABQ96755.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588556-1|ABQ96754.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588555-1|ABQ96753.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588554-1|ABQ96752.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588553-1|ABQ96751.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588551-1|ABQ63507.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588550-1|ABQ63506.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588549-1|ABQ63505.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588548-1|ABQ63504.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588547-1|ABQ63503.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588546-1|ABQ63502.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588545-1|ABQ63501.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588544-1|ABQ63500.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588543-1|ABQ63499.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588542-1|ABQ63498.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588541-1|ABQ63497.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588540-1|ABQ63496.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588539-1|ABQ63495.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588538-1|ABQ63494.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588537-1|ABQ63493.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588536-1|ABQ63492.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588535-1|ABQ63491.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588534-1|ABQ63490.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588533-1|ABQ63489.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588532-1|ABQ63488.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588531-1|ABQ63487.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588530-1|ABQ63486.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588529-1|ABQ63485.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588528-1|ABQ63484.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588527-1|ABQ63483.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588526-1|ABQ63482.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588525-1|ABQ63481.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588524-1|ABQ63480.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588523-1|ABQ63479.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588522-1|ABQ63478.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588521-1|ABQ63477.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588520-1|ABQ63476.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588519-1|ABQ63475.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588518-1|ABQ96750.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588517-1|ABQ96749.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588516-1|ABQ96748.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588515-1|ABQ96747.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588514-1|ABQ96746.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588512-1|ABQ96745.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588509-1|ABQ96744.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588508-1|ABQ96743.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588507-1|ABQ96742.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588506-1|ABQ96741.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588505-1|ABQ96740.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588504-1|ABQ96739.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588503-1|ABQ96738.1| 169|Anopheles gambiae transposase protein. Length = 169 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588502-1|ABQ96737.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588501-1|ABQ96736.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588500-1|ABQ96735.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588499-1|ABQ96734.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588498-1|ABQ96733.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588497-1|ABQ96732.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588496-1|ABQ96731.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588494-1|ABQ96730.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588493-1|ABQ96729.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588492-1|ABQ96728.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588491-1|ABQ96727.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588490-1|ABQ96726.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588489-1|ABQ96725.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588488-1|ABQ96724.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588487-1|ABQ96723.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588486-1|ABQ96722.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588485-1|ABQ96721.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588484-1|ABQ96720.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588483-1|ABQ96719.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588482-1|ABQ96718.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588481-1|ABQ96717.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588480-1|ABQ96716.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588479-1|ABQ96715.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588478-1|ABQ96714.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588477-1|ABQ96713.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588476-1|ABQ96712.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588475-1|ABQ96711.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588474-1|ABQ96710.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588473-1|ABQ96709.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588472-1|ABQ96708.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588471-1|ABQ96707.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588470-1|ABQ96706.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588469-1|ABQ96705.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588468-1|ABQ96704.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588467-1|ABQ96703.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588466-1|ABQ96702.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588465-1|ABQ96701.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588464-1|ABQ96700.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588463-1|ABQ96699.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588462-1|ABQ96698.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588461-1|ABQ96697.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 119 >EF588459-1|ABQ96695.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588458-1|ABQ96694.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588457-1|ABQ96693.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588456-1|ABQ96692.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588455-1|ABQ96691.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588454-1|ABQ96690.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588453-1|ABQ96689.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588452-1|ABQ96688.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588451-1|ABQ96687.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588450-1|ABQ96686.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588449-1|ABQ96685.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588448-1|ABQ96684.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588447-1|ABQ96683.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588446-1|ABQ96682.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588445-1|ABQ96681.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588444-1|ABQ96680.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588443-1|ABQ96679.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588442-1|ABQ96678.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588441-1|ABQ96677.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588440-1|ABQ96676.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588439-1|ABQ96675.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLGLICKEC 120 >EF588438-1|ABQ96674.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588437-1|ABQ96673.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >EF588436-1|ABQ96672.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588435-1|ABQ96671.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588434-1|ABQ96670.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588433-1|ABQ96669.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588432-1|ABQ96668.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588431-1|ABQ96667.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588430-1|ABQ96666.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588429-1|ABQ96665.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >EF588428-1|ABQ96664.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKLINSETKKVLDRMLLDLICKEC 120 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L ++ +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINSETKKVLDRMLLDLICKEC 120 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 2.9 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +2 Query: 377 LIDFLEKGTTNLQRCTYLVLDEADR 451 L+ ++E+GT +Q + L++DE + Sbjct: 133 LLQYIEQGTVRVQDISLLIVDECHK 157 >EF588653-1|ABQ96839.1| 176|Anopheles gambiae transposase protein. Length = 176 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L + +V + + IC+ C Sbjct: 81 SNQYFNSNMSIQGYLKKPINNETKKVLDRMLLDLICKEC 119 >EF588460-1|ABQ96696.1| 177|Anopheles gambiae transposase protein. Length = 177 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -2 Query: 364 SNDYFYSPLQVPGLLSFRSTTKHTRVTNIRCVSKICRTC 248 SN YF S + + G L + +V + + IC+ C Sbjct: 82 SNQYFNSNMSIQGYLKKPINNETKKVLDRMLLDLICKEC 120 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.0 bits (47), Expect = 9.0 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 432 FLMRLIVCWIWDLNHKSEK 488 F+ + CW WDL K K Sbjct: 515 FVRYMNSCWCWDLEKKFPK 533 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 780,027 Number of Sequences: 2352 Number of extensions: 17107 Number of successful extensions: 255 Number of sequences better than 10.0: 226 Number of HSP's better than 10.0 without gapping: 248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 254 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -