BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060090.seq (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 79 4e-17 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 8.3 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 79.0 bits (186), Expect = 4e-17 Identities = 36/78 (46%), Positives = 47/78 (60%) Frame = +2 Query: 263 FGHTSYVRNTCVFGGAPKREQARDLERGVEIVIATPGRLIDFLEKGTTNLQRCTYLVLDE 442 F S ++ +GG Q L G I++ATPGRL+DF+EKG +LVLDE Sbjct: 296 FSLNSILKTVVAYGGTSVMHQRGKLSAGCHILVATPGRLLDFVEKGRVKFSSVQFLVLDE 355 Query: 443 ADRMLDMGFEPQIRKIIE 496 ADRMLDMGF P I K+++ Sbjct: 356 ADRMLDMGFLPSIEKMVD 373 Score = 37.9 bits (84), Expect = 9e-05 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +1 Query: 1 RHEVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 102 R+ V +K GYK+PTP+Q PI M+G++L+ Sbjct: 204 RNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLM 237 Score = 37.5 bits (83), Expect = 1e-04 Identities = 16/31 (51%), Positives = 24/31 (77%) Frame = +1 Query: 511 RQTLMWSATWPKEVKKLAEDYLGDYIQINIG 603 RQTLM+SAT+P EV+ LA +L +Y+ + +G Sbjct: 383 RQTLMFSATFPDEVQHLARRFLNNYLFLAVG 413 Score = 25.0 bits (52), Expect = 0.67 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 Query: 111 QTGSGKTLAYILPAI 155 QTGSGKT A+ +P I Sbjct: 241 QTGSGKTAAFAVPII 255 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 8.3 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 195 HHLSE*AVGCLCAQWLARCRPTFCRNPFEYA 103 +++SE V L + +PT N FEYA Sbjct: 180 NYMSELTVDILLETAMGVSKPTRDHNAFEYA 210 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,116 Number of Sequences: 438 Number of extensions: 4685 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -