BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060089.seq (692 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 40 2e-05 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 22 5.5 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 39.9 bits (89), Expect = 2e-05 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 4/56 (7%) Frame = +1 Query: 532 QTGSGKTLAYILPAIVHI--NNQPPIRRGD--GPIALVLAPTRELAQXIQQVAADF 687 QTGSGKT A++LP I ++ + PP + P+ ++++PTRELA I F Sbjct: 203 QTGSGKTAAFMLPIIHNLLSDKNPPNTENNCAQPVVVIMSPTRELAIQIADQGKKF 258 Score = 39.1 bits (87), Expect = 3e-05 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = +3 Query: 360 EVTVSGVEVXNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 EV V+G + PI FE + ++ + VK GY +PT IQ P+ +S R Sbjct: 145 EVKVTGNDAPPPITSFETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGR 196 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.8 bits (44), Expect = 5.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 105 AIIPVTRHDXFSDLVEDVYL 46 A++PV +H LV VYL Sbjct: 18 ALLPVKKHHRLEKLVPCVYL 37 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,796 Number of Sequences: 336 Number of extensions: 3045 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -