BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060089.seq (692 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 41 3e-05 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 26 0.98 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 25 2.3 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 41.1 bits (92), Expect = 3e-05 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Frame = +1 Query: 532 QTGSGKTLAYILPAIVH-INNQPPIR-RGDGPIALVLAPTRELAQXIQQVAADF 687 QTGSGKT A++LP I H ++ + + R P +++APTRELA I F Sbjct: 219 QTGSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELAIQIHDEGRKF 272 Score = 35.9 bits (79), Expect = 0.001 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +3 Query: 360 EVTVSGVEVXNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 +V VSG + ++ FE + + V V+ Y +PTPIQ PI ++ R Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGR 212 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 26.2 bits (55), Expect = 0.98 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 113 TVVPNLEEATNSAIIRLDLATVAVDLEDLEDLVGKKNSLE 232 T++ +L+E S + LDL +D +L +L +SLE Sbjct: 140 TMLRDLDEGCRSRVQYLDLKLNEIDTVNLAELAASSDSLE 179 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 25.0 bits (52), Expect = 2.3 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 511 KEFSWRXQTGSGKTLAYILPAIVHINNQPPIRRGDG 618 K +++ Q + ++ I A+V + Q +RR DG Sbjct: 457 KTLNYKAQKAAARSHVKIFKALVRLRKQRTLRRNDG 492 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 649,442 Number of Sequences: 2352 Number of extensions: 11812 Number of successful extensions: 31 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -