BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060087.seq (575 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 72 3e-13 SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) 37 0.014 SB_6110| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.018 SB_51892| Best HMM Match : WD40 (HMM E-Value=8.7e-14) 36 0.031 SB_23694| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.072 SB_6741| Best HMM Match : WD40 (HMM E-Value=0) 34 0.096 SB_24139| Best HMM Match : WD40 (HMM E-Value=8.29989e-42) 34 0.096 SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_5612| Best HMM Match : WD40 (HMM E-Value=4.4e-18) 32 0.39 SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_58364| Best HMM Match : WD40 (HMM E-Value=2.8026e-45) 31 0.67 SB_11169| Best HMM Match : WD40 (HMM E-Value=5.5001e-42) 30 1.2 SB_56034| Best HMM Match : GATA (HMM E-Value=5.6e-17) 30 1.6 SB_8639| Best HMM Match : WD40 (HMM E-Value=1.9e-22) 29 2.1 SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_39216| Best HMM Match : WD40 (HMM E-Value=1.1e-14) 29 2.1 SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_49401| Best HMM Match : WD40 (HMM E-Value=1.6e-22) 29 2.7 SB_42279| Best HMM Match : WD40 (HMM E-Value=2.2e-10) 29 2.7 SB_39225| Best HMM Match : NIF (HMM E-Value=0) 29 2.7 SB_45687| Best HMM Match : WD40 (HMM E-Value=4.5e-16) 29 2.7 SB_8765| Best HMM Match : WD40 (HMM E-Value=3.9e-15) 29 3.6 SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_44417| Best HMM Match : RdRP_2 (HMM E-Value=5.6) 29 3.6 SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24) 28 6.3 SB_57418| Best HMM Match : WD40 (HMM E-Value=4.5e-15) 28 6.3 SB_51303| Best HMM Match : WD40 (HMM E-Value=3.5e-40) 28 6.3 SB_24742| Best HMM Match : E-MAP-115 (HMM E-Value=4.8) 28 6.3 SB_12443| Best HMM Match : WD40 (HMM E-Value=1e-24) 28 6.3 SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_21488| Best HMM Match : WD40 (HMM E-Value=3.5e-16) 27 8.3 >SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) Length = 458 Score = 72.1 bits (169), Expect = 3e-13 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = +1 Query: 256 KSVAIFNLERSRLSQDFIFKGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTR 417 ++ ++F L++ RL+ D I+KGH SVDQLCWH S P L TASGDK++R W R Sbjct: 55 RTASVFVLDKDRLTLDHIYKGHNESVDQLCWHPSNPDLFVTASGDKTIRIWDAR 108 Score = 63.7 bits (148), Expect = 1e-10 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = +2 Query: 122 IEDLSELRSYFASHNTTREYIAHSSKVHSVGWSCDGRKLASGSF 253 ++ L+E+R +F + T+++ AH+SKVHSV WSCDGR+LASGSF Sbjct: 10 LDYLNEMRKHFECNTKTKDFTAHNSKVHSVSWSCDGRRLASGSF 53 >SB_14111| Best HMM Match : WD40 (HMM E-Value=6.2e-30) Length = 1093 Score = 36.7 bits (81), Expect = 0.014 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = +1 Query: 313 KGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATIPT--KGXNLNIAWAPNG 486 + HT V++L W+ LL++ S D SVR W T + T G ++ W+P G Sbjct: 201 QAHTSGVNRLDWNPVYTNLLASCSMDNSVRVWDTYLNGICVKSHTFHGGAVKDVKWSPGG 260 Query: 487 QH--HCGW 504 CG+ Sbjct: 261 MQLLSCGY 268 >SB_6110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2051 Score = 36.3 bits (80), Expect = 0.018 Identities = 21/57 (36%), Positives = 33/57 (57%) Frame = +1 Query: 253 RKSVAIFNLERSRLSQDFIFKGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSH 423 R+ + F+L++++L F GH+G+V LC S LS AS DK+V+ W +H Sbjct: 1718 RERKSQFHLQQAKLQT---FTGHSGAVRSLCIQDSEHYFLS-ASKDKTVKLWSLSNH 1770 >SB_51892| Best HMM Match : WD40 (HMM E-Value=8.7e-14) Length = 353 Score = 35.5 bits (78), Expect = 0.031 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 310 FKGHTGSVDQLCWHASXPXLLSTASGDKSVRXW 408 F GHTG + Q+ W+ P T S D SVR W Sbjct: 111 FHGHTGPIYQVKWNPLYPEAFLTCSADWSVRLW 143 >SB_23694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 34.3 bits (75), Expect = 0.072 Identities = 18/65 (27%), Positives = 32/65 (49%) Frame = +1 Query: 295 SQDFIFKGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATIPTKGXNLNIAW 474 ++ +++GH+G V + + L +T S DKSV+ W + + T+ +I W Sbjct: 24 TEALVYEGHSGMVRCVTVDPTGQWL-ATGSDDKSVKFWEVATGRCTKTVTLDRSIQSIDW 82 Query: 475 APNGQ 489 PN Q Sbjct: 83 NPNPQ 87 >SB_6741| Best HMM Match : WD40 (HMM E-Value=0) Length = 714 Score = 33.9 bits (74), Expect = 0.096 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +1 Query: 304 FIFKGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATIPTKGXNLNI 468 ++ HT V C+ A+ +L++ SGDK+ R W A P G N ++ Sbjct: 6 YVISRHTKDVTGCCFSANS-RVLASCSGDKTARLWDVEKGTELAQSPLDGHNYHV 59 >SB_24139| Best HMM Match : WD40 (HMM E-Value=8.29989e-42) Length = 198 Score = 33.9 bits (74), Expect = 0.096 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +1 Query: 304 FIFKGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATIPTKGXNLNI 468 ++ HT V C+ A+ +L++ SGDK+ R W A P G N ++ Sbjct: 6 YVISRHTKDVTGCCFSANS-RVLASCSGDKTARLWDVEKGTELAQSPLDGHNYHV 59 >SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 998 Score = 33.1 bits (72), Expect = 0.17 Identities = 12/42 (28%), Positives = 25/42 (59%) Frame = +1 Query: 316 GHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATI 441 GHT +V+ + W+ P ++++AS D +VR W + + + + Sbjct: 245 GHTRTVNCVTWNPLVPSMMASASDDGTVRIWGPSTEETSGNL 286 >SB_5612| Best HMM Match : WD40 (HMM E-Value=4.4e-18) Length = 736 Score = 31.9 bits (69), Expect = 0.39 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +1 Query: 316 GHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATIPTK-GXNLNIAWA 477 GH G V L W P L T+S D S + W +++ A G +++ W+ Sbjct: 20 GHCGRVTALSWSPHHPDRLVTSSYDGSAQVWDVETNQPIANYRGHVGRVMSVCWS 74 Score = 31.9 bits (69), Expect = 0.39 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 310 FKGHTGSVDQLCWHASXPXLLSTASGDKSVRXW 408 ++GH G V +CW P ++ + D +VR W Sbjct: 61 YRGHVGRVMSVCWSYLDPDVVFSGGEDGTVRPW 93 >SB_3361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 31.9 bits (69), Expect = 0.39 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 286 SRLSQDFIFKGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHK 426 +R + +FK HT +V + + LL TAS DKS++ W K Sbjct: 16 NRKGESTVFKAHTATVRSVDFSGDGQSLL-TASDDKSLKVWTVHRQK 61 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 31.5 bits (68), Expect = 0.51 Identities = 17/62 (27%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Frame = +1 Query: 310 FKGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAA-TIPTKGXNLNIAWAPNG 486 F H G V L WH ++T DK V+ W + I T I W P Sbjct: 417 FMAHNGPVFTLDWHPEDRNWIATGGRDKCVKVWDVQGKATPVNNIQTISSVSRIKWRPQK 476 Query: 487 QH 492 ++ Sbjct: 477 KY 478 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 31.5 bits (68), Expect = 0.51 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +1 Query: 310 FKGHTGSVDQLCWHASXPXLLSTASGDKSVRXW 408 F GHTG V LC H LL + S DK+++ W Sbjct: 456 FVGHTGPVWALCVHGE---LLFSGSSDKTIKIW 485 >SB_58364| Best HMM Match : WD40 (HMM E-Value=2.8026e-45) Length = 426 Score = 31.1 bits (67), Expect = 0.67 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +1 Query: 313 KGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATIP 444 K H+G + L W +L TASGDKS + W K T P Sbjct: 202 KAHSGGIYGLSWSDDSKFIL-TASGDKSCKIWNIED-KSLQTFP 243 >SB_11169| Best HMM Match : WD40 (HMM E-Value=5.5001e-42) Length = 383 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +1 Query: 313 KGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATIPTK--GXNLNIAWAPNG 486 +GH G+V+ + + + S S DKS+R W S K T+ G + +AP+G Sbjct: 185 RGHQGAVNVVAFSLDNRYIFS-GSDDKSIRIWSRESSKCENTLTDSLGGEVRCLRFAPHG 243 Query: 487 Q 489 + Sbjct: 244 E 244 >SB_56034| Best HMM Match : GATA (HMM E-Value=5.6e-17) Length = 297 Score = 29.9 bits (64), Expect = 1.6 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +2 Query: 71 FYMITKAMKDSKHSQAPIEDLSELRSYFASHNTTREYIAHSSKVHSVGWSCDG-RKLASG 247 FYM + DSK + I +L +S+F + N T + S K +G S D R LAS Sbjct: 3 FYMKKHSFFDSKRIPSSIAELERYKSFFTNLNET-SHSGISIKKAKIGQSPDSIRSLASC 61 Query: 248 S 250 S Sbjct: 62 S 62 >SB_8639| Best HMM Match : WD40 (HMM E-Value=1.9e-22) Length = 442 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 316 GHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSH 423 GH G+V L W+ +++T S D V W H Sbjct: 13 GHKGAVLDLAWNPFDDHMIATGSEDARVMIWQIPEH 48 >SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +1 Query: 319 HTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXA--ATIPTKGXNLNIAWAPNGQ 489 HT V+ L ++ +L+T S DK+V W R+ K + K + W+P+ + Sbjct: 320 HTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNE 378 >SB_39216| Best HMM Match : WD40 (HMM E-Value=1.1e-14) Length = 867 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/59 (23%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +1 Query: 316 GHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATIPTKGXNL-NIAWAPNGQ 489 GH + + +H + LL++A+ D +V+ W + K T+ + ++AW+ +G+ Sbjct: 108 GHYDKPNIVRYHPNAENLLTSAAYDLTVKLWDINAAKSVITLEGHNEQVFSLAWSADGK 166 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 188 HSSKVHSVGWSCDGRKLASGSFVKALQ 268 H+ +V S+ WS DG++LA+ S K L+ Sbjct: 152 HNEQVFSLAWSADGKQLATFSRDKKLR 178 >SB_19258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 459 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 188 HSSKVHSVGWSCDGRKLASGSFVK 259 H V+++ +S DGR LASGSF K Sbjct: 332 HHEPVYTISFSPDGRYLASGSFDK 355 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +1 Query: 370 LSTASGDKSVRXWXTRSHKXAATIPTKGXNLNIAWAPNG 486 L++ S DK V W T++ + G + W+P G Sbjct: 348 LASGSFDKRVHIWSTQTGNLVHSFQGSGGIFEVQWSPRG 386 >SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 316 GHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSH 423 GH G+V L W+ +++T S D V W H Sbjct: 77 GHKGAVLDLAWNPFDDHMIATGSEDARVMIWQIPEH 112 >SB_49401| Best HMM Match : WD40 (HMM E-Value=1.6e-22) Length = 453 Score = 29.1 bits (62), Expect = 2.7 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 2/75 (2%) Frame = +1 Query: 262 VAIFNLERSRLSQDFIFK-GHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAAT 438 V +++L + R S F+ + GH ++ + A +L+TAS D +V+ W + + Sbjct: 350 VGLYDLGKRRWS--FLREMGHVETIFDCKFKADDADMLATASFDGTVKVWDVDTLSGVHS 407 Query: 439 IP-TKGXNLNIAWAP 480 P +G ++WAP Sbjct: 408 SPGNEGIIYALSWAP 422 >SB_42279| Best HMM Match : WD40 (HMM E-Value=2.2e-10) Length = 291 Score = 29.1 bits (62), Expect = 2.7 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 2/75 (2%) Frame = +1 Query: 262 VAIFNLERSRLSQDFIFK-GHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAAT 438 V +++L + R S F+ + GH ++ + A +L+TAS D +V+ W + + Sbjct: 188 VGLYDLGKRRWS--FLREMGHVETIFDCKFKADDADMLATASFDGTVKVWDVDTLSGVHS 245 Query: 439 IP-TKGXNLNIAWAP 480 P +G ++WAP Sbjct: 246 SPGNEGIIYALSWAP 260 >SB_39225| Best HMM Match : NIF (HMM E-Value=0) Length = 1772 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 307 IFKGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRS 420 + +GHT SV+ C + TAS DK++R W S Sbjct: 34 VMRGHTDSVNS-CRFCFDDAKIVTASHDKTIRLWDASS 70 >SB_45687| Best HMM Match : WD40 (HMM E-Value=4.5e-16) Length = 301 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 310 FKGHTGSVDQL--CWHASXPXLLSTASGDKSVRXW 408 F HT V + C HA P L ++ + DK+VR W Sbjct: 135 FTEHTDRVSSVRFCPHALHPGLCASGADDKTVRLW 169 >SB_8765| Best HMM Match : WD40 (HMM E-Value=3.9e-15) Length = 481 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/60 (23%), Positives = 29/60 (48%) Frame = +1 Query: 310 FKGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATIPTKGXNLNIAWAPNGQ 489 +K H G V ++ W+ +LS D + W + ++ P + +++WAP+G+ Sbjct: 47 WKAHEGIVLKIDWNPINNLILSGGE-DCKYKVWDSYGRVLYSSAPHEYPITSVSWAPDGE 105 >SB_5618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/61 (26%), Positives = 28/61 (45%) Frame = +1 Query: 310 FKGHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATIPTKGXNLNIAWAPNGQ 489 F+GHT V+ + + A ++S AS D +++ W +S + T L+ N Sbjct: 345 FRGHTSFVNDVIFTADAHHIIS-ASSDGTIKIWNIKSTECQHTFKPSVGGLSSEITVNSV 403 Query: 490 H 492 H Sbjct: 404 H 404 >SB_44417| Best HMM Match : RdRP_2 (HMM E-Value=5.6) Length = 541 Score = 28.7 bits (61), Expect = 3.6 Identities = 19/51 (37%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -3 Query: 234 FLPSQDQPTECTLDECAMYSRVVLCDAK*LRNS--LKSSIGACECFESFIA 88 FLPS TEC L C Y V LR S L S EC +F++ Sbjct: 58 FLPSHTATTECALTFCHRYEEVCSYLLTPLRGSVPLPSHTSTRECVFTFLS 108 >SB_41443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 28.7 bits (61), Expect = 3.6 Identities = 21/99 (21%), Positives = 41/99 (41%), Gaps = 7/99 (7%) Frame = +1 Query: 274 NLERSRLSQDFIF--KGHTGSVDQLCWHASXPXLLSTASG--DKSVRXWXTRSHKXAATI 441 N+ S +S + +F H +V L W +L++ G D+ ++ W + +I Sbjct: 321 NISASGISSNSLFCLSQHQAAVKALDWCPFQRNVLASGGGTADRQIKFWNASTGSCLNSI 380 Query: 442 PTKGXNLNIAWAPNGQH---HCGWGQGVXVPFSVPKLYK 549 TK +I W+ + G+ Q + + P + K Sbjct: 381 DTKSQVCSILWSKEYKELISSHGYAQNQLIVWKYPSMTK 419 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/63 (20%), Positives = 27/63 (42%), Gaps = 5/63 (7%) Frame = +1 Query: 307 IFKGHTGSVDQLCWHASXPXLLSTASGDKSVRXW----XTRSHKXAATIPTKG-XNLNIA 471 + +GH+ + + W P LL + + D + W T ++ +PT + ++ Sbjct: 256 VLEGHSRGILSIAWCPQDPDLLMSCAKDNRILCWNPNEQTAGNEIVYELPTTAQWSFDVK 315 Query: 472 WAP 480 W P Sbjct: 316 WCP 318 >SB_6763| Best HMM Match : WD40 (HMM E-Value=4.6e-24) Length = 208 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +1 Query: 316 GHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATI 441 GH ++Q+C+ L+++A+ DKSV+ W + K ++ Sbjct: 57 GHQALINQVCFSPDG-RLIASAAFDKSVKLWNGETGKFITSL 97 >SB_57418| Best HMM Match : WD40 (HMM E-Value=4.5e-15) Length = 365 Score = 27.9 bits (59), Expect = 6.3 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = +1 Query: 307 IFKGHTGSVDQLCWHASXPXLLSTASGDKSVRXW 408 +FK TG + + WH + + + +S D + W Sbjct: 270 LFKHSTGPITSVEWHPTDGSVFAASSADNQITLW 303 >SB_51303| Best HMM Match : WD40 (HMM E-Value=3.5e-40) Length = 400 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/45 (22%), Positives = 23/45 (51%) Frame = +1 Query: 319 HTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAATIPTKG 453 H S++ + W+ + T+S D++++ W T + + T +G Sbjct: 98 HRSSIETVQWYPHDSGMFLTSSVDRTLKVWDTNALQVVETFNFEG 142 >SB_24742| Best HMM Match : E-MAP-115 (HMM E-Value=4.8) Length = 215 Score = 27.9 bits (59), Expect = 6.3 Identities = 15/64 (23%), Positives = 29/64 (45%) Frame = +2 Query: 2 GTRNSRQINKKH*QENN*SFNVKFYMITKAMKDSKHSQAPIEDLSELRSYFASHNTTREY 181 GT+ ++ +K + N + K A + + +AP+ D+ EL+ A+ EY Sbjct: 85 GTKKNKDTKQKESRTRNAESSRKSDTYRGANESRRDYRAPVADIDELKQSIANVQEQEEY 144 Query: 182 IAHS 193 + S Sbjct: 145 VLSS 148 >SB_12443| Best HMM Match : WD40 (HMM E-Value=1e-24) Length = 515 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 316 GHTGSVDQLCWHASXPXLLSTASGDKSVRXWXTRSHKXAA 435 GH V+ + ++ P +L +AS D ++R W +R A Sbjct: 475 GHQNVVNCVAFNPRDPDMLVSASDDHTLRVWKSRRRSGKA 514 >SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2323 Score = 27.9 bits (59), Expect = 6.3 Identities = 15/64 (23%), Positives = 29/64 (45%) Frame = +2 Query: 2 GTRNSRQINKKH*QENN*SFNVKFYMITKAMKDSKHSQAPIEDLSELRSYFASHNTTREY 181 GT+ ++ +K + N + K A + + +AP+ D+ EL+ A+ EY Sbjct: 1748 GTKKNKDTKQKESRTRNAESSRKSDTYRGANESRRDYRAPVADIDELKQSIANVQEQEEY 1807 Query: 182 IAHS 193 + S Sbjct: 1808 VLSS 1811 >SB_21488| Best HMM Match : WD40 (HMM E-Value=3.5e-16) Length = 675 Score = 27.5 bits (58), Expect = 8.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 149 YFASHNTTREYIAHSSKVHSVGWSCDGRKLASG 247 Y +T R Y H+ V S+ DGR +ASG Sbjct: 162 YNLKKHTQRHYTQHTDDVKSLAVHPDGRTIASG 194 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,663,487 Number of Sequences: 59808 Number of extensions: 317797 Number of successful extensions: 715 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -