BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060086.seq (572 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 22 4.3 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 22 4.3 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.9 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 9.9 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 21 9.9 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.8 bits (44), Expect = 4.3 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 146 SYFASHNTTREYIAHSSKVHSVGWSCDGRKLASGS 250 S FA++N HS VH+ G SGS Sbjct: 60 SVFAANNAEFPEFVHSGMVHNDGTQLMPSPTVSGS 94 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 21.8 bits (44), Expect = 4.3 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 146 SYFASHNTTREYIAHSSKVHSVGWSCDGRKLASGS 250 S FA++N HS VH+ G SGS Sbjct: 60 SVFAANNAEFPEFVHSGMVHNDGTQLMPSPTVSGS 94 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 20.6 bits (41), Expect = 9.9 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +3 Query: 285 EQIESRFYFQRPHRXCRSTLLACVTS*SPEYXXRRQI 395 EQ+ R F PHR + C + +P R+ I Sbjct: 594 EQLTWRRNFHGPHRLAARSRRCCYHAVAPGTDIRQSI 630 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 20.6 bits (41), Expect = 9.9 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +3 Query: 285 EQIESRFYFQRPHRXCRSTLLACVTS*SPEYXXRRQI 395 EQ+ R F PHR + C + +P R+ I Sbjct: 486 EQLTWRRNFHGPHRLAARSRRCCYHAVAPGTDIRQSI 522 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 20.6 bits (41), Expect = 9.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 492 CCPLGXHAIFMFSTFGWDCRRAFV 421 C + HAI + STF W F+ Sbjct: 86 CKAILVHAITIRSTFSWTFIDVFI 109 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,168 Number of Sequences: 336 Number of extensions: 2384 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14203976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -