BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060085.seq (677 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_31796| Best HMM Match : SAP (HMM E-Value=3.5e-10) 28 8.0 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/52 (30%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = +3 Query: 330 PTCPTRCSNSSLDP---THRQLKNCATRCNCFC*TYIPYLTTTDPCRPASSI 476 P CP RC + L P H C + C+ C P T C PA + Sbjct: 1413 PDCPARCCITVLQPLNEKHNTTAECPSECSETCKPECPVKCCTGEC-PAGCL 1463 >SB_31796| Best HMM Match : SAP (HMM E-Value=3.5e-10) Length = 1029 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 293 TEMRLYKEFKILANMSNALLKQQFGPDTPTIEEL 394 T+M Y+E +I + A++KQQ G D I E+ Sbjct: 783 TDMDTYQEQEITQELQRAMMKQQVGLDHDEILEI 816 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,891,326 Number of Sequences: 59808 Number of extensions: 490657 Number of successful extensions: 1120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1118 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -