BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060081.seq (575 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42230| Best HMM Match : PFK (HMM E-Value=0) 106 1e-23 SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.29 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 32 0.39 SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) 32 0.39 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 31 0.67 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 31 0.89 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 31 0.89 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 31 0.89 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 30 1.6 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 30 1.6 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 30 1.6 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 30 1.6 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 29 2.1 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 29 2.7 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 29 2.7 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 29 2.7 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 29 2.7 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_37721| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 29 2.7 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 29 2.7 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 29 3.6 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 29 3.6 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 29 3.6 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) 29 3.6 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 29 3.6 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 28 4.8 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 28 4.8 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 28 4.8 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 28 4.8 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 28 4.8 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 28 4.8 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 28 4.8 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) 28 4.8 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 28 4.8 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 28 6.3 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 28 6.3 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 28 6.3 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 28 6.3 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 28 6.3 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 28 6.3 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 28 6.3 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 28 6.3 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 28 6.3 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 28 6.3 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 28 6.3 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 28 6.3 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 27 8.3 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 27 8.3 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 27 8.3 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 27 8.3 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 27 8.3 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 27 8.3 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 27 8.3 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 27 8.3 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 27 8.3 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 27 8.3 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_40059| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 27 8.3 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 27 8.3 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 27 8.3 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 27 8.3 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 27 8.3 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 27 8.3 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 27 8.3 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 27 8.3 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_42230| Best HMM Match : PFK (HMM E-Value=0) Length = 1103 Score = 106 bits (254), Expect = 1e-23 Identities = 48/71 (67%), Positives = 56/71 (78%) Frame = +1 Query: 40 LTGANLFRQEWSSLLDELLENNKITKDQREKYKFLHIAGMVGSIDNDFCGTDMTIGTDSA 219 LTGAN F+QEW+ LL+EL+ IT + K L+I GMVGSIDNDFCGTDMTIGTD+A Sbjct: 657 LTGANYFKQEWTGLLEELVSKGSITPEMAAKNNSLNIVGMVGSIDNDFCGTDMTIGTDTA 716 Query: 220 LHRIIEAIDAI 252 LHRI EA+DAI Sbjct: 717 LHRIFEAVDAI 727 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = +3 Query: 255 STAYSHQRTFIMEVMGRNCGYXALVAALASEAYQVFIPED 374 S SH+R F++E MG CGY A ++ALAS A +I E+ Sbjct: 1015 SALSSHKRVFVIECMGGYCGYLATMSALASGADAAYIFEE 1054 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/53 (32%), Positives = 22/53 (41%) Frame = +3 Query: 315 YXALVAALASEAYQVFIPEDPVPNNWVXKXXXXXXXXXXXXXXXNXIIXAEGA 473 Y ALV ++ A VFIPE P + W + +I AEGA Sbjct: 734 YLALVTSVGVGADYVFIPEWPAEDGWEDRMCRHLHRIRESGRRLCIVILAEGA 786 >SB_59110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.13 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -2 Query: 52 WHQSARAEFLQPGGSTS 2 WHQ+ EFLQPGGSTS Sbjct: 6 WHQNTVIEFLQPGGSTS 22 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 Query: 69 FLSEQIGTSQLVPNSCSPGDPLV 1 FL + T ++ NSCSPGDPLV Sbjct: 3 FLRRSLVTDEIRSNSCSPGDPLV 25 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 31.9 bits (69), Expect = 0.39 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -3 Query: 66 LSEQIGTSQLVPNSCSPGDPLV 1 L +I + Q NSCSPGDPLV Sbjct: 469 LQGEIASGQTTSNSCSPGDPLV 490 >SB_7722| Best HMM Match : TFR_dimer (HMM E-Value=2.6e-10) Length = 688 Score = 31.9 bits (69), Expect = 0.39 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +3 Query: 279 TFIMEVMGRNCGYXALVAALASEAYQVFIPEDP---VPNNW 392 TFI V R+ GY +AAL + + F PE P PN+W Sbjct: 179 TFIDTVKVRSAGYNGAIAALIYQDPEQFAPEGPNNTFPNSW 219 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 31.5 bits (68), Expect = 0.51 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 51 GTSQLVPNSCSPGDPLV 1 G + +V NSCSPGDPLV Sbjct: 73 GVNTIVSNSCSPGDPLV 89 >SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.5 bits (68), Expect = 0.51 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 54 IGTSQLVPNSCSPGDPLV 1 IG+ ++ NSCSPGDPLV Sbjct: 17 IGSYEVTSNSCSPGDPLV 34 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 31.5 bits (68), Expect = 0.51 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 63 SEQIGTSQLVPNSCSPGDPLV 1 SE + T V NSCSPGDPLV Sbjct: 50 SENLRTIPPVSNSCSPGDPLV 70 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 31.5 bits (68), Expect = 0.51 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 T ++V NSCSPGDPLV Sbjct: 82 TQRIVSNSCSPGDPLV 97 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 31.5 bits (68), Expect = 0.51 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 93 QFIKKARPFLSEQIGTSQLVPNSCSPGDPLV 1 + + + P L + S L+ NSCSPGDPLV Sbjct: 17 KMLVRGPPLLRSTVSIS-LISNSCSPGDPLV 46 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 31.1 bits (67), Expect = 0.67 Identities = 16/26 (61%), Positives = 17/26 (65%), Gaps = 3/26 (11%) Frame = -2 Query: 70 ILVGTNWHQSARA---EFLQPGGSTS 2 IL WH S+R EFLQPGGSTS Sbjct: 96 ILRKGKWHSSSRGPNIEFLQPGGSTS 121 >SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.1 bits (67), Expect = 0.67 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -3 Query: 69 FLSEQIGTSQLVPNSCSPGDPLV 1 +L+ ++GTS NSCSPGDPLV Sbjct: 8 YLNPEVGTS----NSCSPGDPLV 26 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.1 bits (67), Expect = 0.67 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 T +L NSCSPGDPLV Sbjct: 8 TQELTSNSCSPGDPLV 23 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.1 bits (67), Expect = 0.67 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 54 IGTSQLVPNSCSPGDPLV 1 I ++Q+ NSCSPGDPLV Sbjct: 32 IPSTQMASNSCSPGDPLV 49 >SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) Length = 499 Score = 30.7 bits (66), Expect = 0.89 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 55 NWHQSARAEFLQPGGSTS 2 ++HQ+ EFLQPGGSTS Sbjct: 369 HFHQAIEIEFLQPGGSTS 386 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 30.7 bits (66), Expect = 0.89 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +3 Query: 3 LVDPPGCRNSARAD 44 LVDPPGCRNS AD Sbjct: 15 LVDPPGCRNSIAAD 28 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 30.7 bits (66), Expect = 0.89 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -3 Query: 63 SEQIGT-SQLVPNSCSPGDPLV 1 SE + T L+ NSCSPGDPLV Sbjct: 31 SENLWTFKHLISNSCSPGDPLV 52 >SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.7 bits (66), Expect = 0.89 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -3 Query: 51 GTSQLVPNSCSPGDPLV 1 GTS NSCSPGDPLV Sbjct: 23 GTSAKESNSCSPGDPLV 39 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.7 bits (66), Expect = 0.89 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 ++LV NSCSPGDPLV Sbjct: 24 ARLVSNSCSPGDPLV 38 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 30.7 bits (66), Expect = 0.89 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 63 SEQIGTSQLVPNSCSPGDPLV 1 ++ +G +Q NSCSPGDPLV Sbjct: 88 ADALGDAQPPSNSCSPGDPLV 108 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.7 bits (66), Expect = 0.89 Identities = 18/30 (60%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -3 Query: 84 KKARP-FLSEQIGTSQLVP-NSCSPGDPLV 1 KKA+ F T LVP NSCSPGDPLV Sbjct: 11 KKAKSRFAKIPFTTLPLVPSNSCSPGDPLV 40 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 30.7 bits (66), Expect = 0.89 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 54 IGTSQLVPNSCSPGDPLV 1 + + QL NSCSPGDPLV Sbjct: 656 LNSLQLASNSCSPGDPLV 673 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 + LV NSCSPGDPLV Sbjct: 22 AHLVSNSCSPGDPLV 36 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 69 FLSEQIGTSQLVPNSCSPGDPLV 1 F I + ++ NSCSPGDPLV Sbjct: 4 FTDTLISANIIISNSCSPGDPLV 26 >SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 51 GTSQLVPNSCSPGDPLV 1 GT + NSCSPGDPLV Sbjct: 9 GTHMMGSNSCSPGDPLV 25 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 63 SEQIGTSQLVPNSCSPGDPLV 1 S + S+ V NSCSPGDPLV Sbjct: 32 SSPLQPSENVSNSCSPGDPLV 52 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -3 Query: 57 QIGTSQLVPNSCSPGDPLV 1 +IG V NSCSPGDPLV Sbjct: 8 RIGRCWQVSNSCSPGDPLV 26 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -3 Query: 66 LSEQIGTSQLVPNSCSPGDPLV 1 +S I S++ NSCSPGDPLV Sbjct: 9 ISANIVLSRVSSNSCSPGDPLV 30 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.3 bits (65), Expect = 1.2 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = -3 Query: 69 FLSEQIGT--SQLVPNSCSPGDPLV 1 FL E + T ++V NSCSPGDPLV Sbjct: 15 FLREFVYTVIQKVVSNSCSPGDPLV 39 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Frame = -3 Query: 51 GTSQLVP-NSCSPGDPLV 1 GT+ + P NSCSPGDPLV Sbjct: 177 GTTTIPPSNSCSPGDPLV 194 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 S L+ NSCSPGDPLV Sbjct: 15 SFLISNSCSPGDPLV 29 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 LV NSCSPGDPLV Sbjct: 3 LVSNSCSPGDPLV 15 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 SQ NSCSPGDPLV Sbjct: 17 SQTASNSCSPGDPLV 31 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 69 FLSEQIGTSQLVPNSCSPGDPLV 1 F+ Q+ NSCSPGDPLV Sbjct: 72 FIRRGAKRQQMASNSCSPGDPLV 94 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 LV NSCSPGDPLV Sbjct: 17 LVSNSCSPGDPLV 29 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 69 FLSEQIGTSQLVPNSCSPGDPLV 1 F I + ++ NSCSPGDPLV Sbjct: 4 FTDTLISANIVISNSCSPGDPLV 26 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 54 IGTSQLVPNSCSPGDPLV 1 I +++V NSCSPGDPLV Sbjct: 3469 IYVARVVSNSCSPGDPLV 3486 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 LV NSCSPGDPLV Sbjct: 9 LVSNSCSPGDPLV 21 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 T+ L+ NSCSPGDPLV Sbjct: 3 TAILLSNSCSPGDPLV 18 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 LV NSCSPGDPLV Sbjct: 5 LVSNSCSPGDPLV 17 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/24 (58%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -3 Query: 69 FLSEQIGTSQ-LVPNSCSPGDPLV 1 +L E + S+ L NSCSPGDPLV Sbjct: 74 YLHESVPKSEPLSSNSCSPGDPLV 97 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 LV NSCSPGDPLV Sbjct: 2 LVSNSCSPGDPLV 14 >SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -2 Query: 73 TILVGTNWHQSARAEFLQPGGSTS 2 TI G + R EFLQPGGSTS Sbjct: 52 TIEAGEGERELGRIEFLQPGGSTS 75 >SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 134 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 +Q+ NSCSPGDPLV Sbjct: 7 AQITSNSCSPGDPLV 21 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 ++ +V NSCSPGDPLV Sbjct: 10 SANIVSNSCSPGDPLV 25 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 LV NSCSPGDPLV Sbjct: 26 LVSNSCSPGDPLV 38 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 60 EQIGTSQLVPNSCSPGDPLV 1 E + +S NSCSPGDPLV Sbjct: 507 ESVPSSSTPSNSCSPGDPLV 526 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 51 GTSQLVPNSCSPGDPLV 1 G L NSCSPGDPLV Sbjct: 3 GCEPLASNSCSPGDPLV 19 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 SQ NSCSPGDPLV Sbjct: 11 SQTTSNSCSPGDPLV 25 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/15 (86%), Positives = 14/15 (93%), Gaps = 1/15 (6%) Frame = -3 Query: 42 QLVP-NSCSPGDPLV 1 QL+P NSCSPGDPLV Sbjct: 23 QLLPSNSCSPGDPLV 37 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 33 LISNSCSPGDPLV 45 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 60 EQIGTSQLVPNSCSPGDPLV 1 E I ++ NSCSPGDPLV Sbjct: 2 EHIKDAESTSNSCSPGDPLV 21 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 66 LSEQIGTSQLVPNSCSPGDPLV 1 + + G++ + NSCSPGDPLV Sbjct: 3 VKRKFGSNAVRSNSCSPGDPLV 24 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 29.5 bits (63), Expect = 2.1 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 42 QLVPNSCSPGDPLV 1 +++ NSCSPGDPLV Sbjct: 118 EIISNSCSPGDPLV 131 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 37 LISNSCSPGDPLV 49 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 8 LISNSCSPGDPLV 20 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 33 LISNSCSPGDPLV 45 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 2.1 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 ++ ++ NSCSPGDPLV Sbjct: 10 SANIISNSCSPGDPLV 25 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -3 Query: 66 LSEQIGTSQLVPNSCSPGDPLV 1 +S I + V NSCSPGDPLV Sbjct: 9 ISANIISIAFVSNSCSPGDPLV 30 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 33 LISNSCSPGDPLV 45 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 33 LISNSCSPGDPLV 45 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 24 LISNSCSPGDPLV 36 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 33 LISNSCSPGDPLV 45 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 33 LISNSCSPGDPLV 45 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 3 LVDPPGCRNSARA 41 LVDPPGCRNS R+ Sbjct: 15 LVDPPGCRNSIRS 27 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 42 QLVPNSCSPGDPLV 1 Q++ NSCSPGDPLV Sbjct: 12 QVLSNSCSPGDPLV 25 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 66 LSEQIGTSQLVPNSCSPGDPLV 1 L++ S + NSCSPGDPLV Sbjct: 37 LTKSTTESTITSNSCSPGDPLV 58 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 33 LISNSCSPGDPLV 45 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 70 LISNSCSPGDPLV 82 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 21 LISNSCSPGDPLV 33 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 +S L+ NSCSPGDPLV Sbjct: 4 SSFLLSNSCSPGDPLV 19 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 16 LISNSCSPGDPLV 28 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 33 LISNSCSPGDPLV 45 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 2.1 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 ++ ++ NSCSPGDPLV Sbjct: 10 SANIISNSCSPGDPLV 25 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 S ++ NSCSPGDPLV Sbjct: 24 SLIISNSCSPGDPLV 38 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 31 LISNSCSPGDPLV 43 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 +V NSCSPGDPLV Sbjct: 347 IVSNSCSPGDPLV 359 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 Query: 57 QIGTSQLVPNSCSPGDPLV 1 Q S + NSCSPGDPLV Sbjct: 94 QTNKSLKISNSCSPGDPLV 112 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 S V NSCSPGDPLV Sbjct: 4 SDRVSNSCSPGDPLV 18 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 69 FLSEQIGTSQLVPNSCSPGDPLV 1 FL E T + + NSCSPGDPLV Sbjct: 251 FLRENPVT-EYISNSCSPGDPLV 272 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 2.7 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 42 QLVPNSCSPGDPLV 1 +++ NSCSPGDPLV Sbjct: 16 RIISNSCSPGDPLV 29 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 42 QLVPNSCSPGDPLV 1 Q + NSCSPGDPLV Sbjct: 14 QQISNSCSPGDPLV 27 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 T++ + NSCSPGDPLV Sbjct: 58 TAKKLSNSCSPGDPLV 73 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 87 IKKARPFLSEQIGTSQLVPNSCSPGDPLV 1 ++ P +++G NSCSPGDPLV Sbjct: 124 VQAQNPLGRQKVGHFAPSSNSCSPGDPLV 152 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 66 LSEQIGTSQLVPNSCSPGDPLV 1 + ++G NSCSPGDPLV Sbjct: 6 VESRVGVRTPTSNSCSPGDPLV 27 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 Query: 57 QIGTSQLVPNSCSPGDPLV 1 + G S NSCSPGDPLV Sbjct: 12 ETGRSACPSNSCSPGDPLV 30 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +3 Query: 3 LVDPPGCRNSAR 38 LVDPPGCRNS R Sbjct: 15 LVDPPGCRNSIR 26 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 51 GTSQLVPNSCSPGDPLV 1 G + V NSCSPGDPLV Sbjct: 59 GNLRPVSNSCSPGDPLV 75 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -3 Query: 57 QIGTSQLVPNSCSPGDPLV 1 ++G + + NSCSPGDPLV Sbjct: 4 KVGFTCALSNSCSPGDPLV 22 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 99 LQQFIKKARPFLSEQIGTSQLVPNSCSPGDPLV 1 L F + + + + +S NSCSPGDPLV Sbjct: 31 LDNFKPRPEDKIHKIVKSSSRASNSCSPGDPLV 63 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +3 Query: 3 LVDPPGCRNSARA 41 LVDPPGCRNS +A Sbjct: 15 LVDPPGCRNSIQA 27 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 +V NSCSPGDPLV Sbjct: 11 MVSNSCSPGDPLV 23 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 +S + NSCSPGDPLV Sbjct: 2418 SSAIASNSCSPGDPLV 2433 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 +Q + NSCSPGDPLV Sbjct: 3 AQHISNSCSPGDPLV 17 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 60 EQIGTSQLVPNSCSPGDPLV 1 +++G NSCSPGDPLV Sbjct: 11 QELGEYLTASNSCSPGDPLV 30 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 +V NSCSPGDPLV Sbjct: 1 MVSNSCSPGDPLV 13 >SB_40117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 73 TILVGTNWHQSARAEFLQPGGSTS 2 T+ + HQS + EFLQPGGSTS Sbjct: 38 TVFARYHGHQS-KIEFLQPGGSTS 60 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 T ++ NSCSPGDPLV Sbjct: 2 TIVIISNSCSPGDPLV 17 >SB_37721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 52 WHQSARAEFLQPGGSTS 2 W+ + EFLQPGGSTS Sbjct: 84 WYDKSVIEFLQPGGSTS 100 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 3 LVDPPGCRNSARAD 44 LVDPPGCRNS A+ Sbjct: 15 LVDPPGCRNSMNAN 28 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -3 Query: 51 GTSQLVPNSCSPGDPLV 1 G +++ NSCSPGDPLV Sbjct: 317 GANRVRSNSCSPGDPLV 333 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 Query: 69 FLSEQIGTSQLVPNSCSPGDPLV 1 F I + V NSCSPGDPLV Sbjct: 4 FTDTLISANISVSNSCSPGDPLV 26 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 29.1 bits (62), Expect = 2.7 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 9/61 (14%) Frame = -3 Query: 156 SSYVQKF-----IFFPLIFSNFVVLQ-QFIKKARPFLSEQIGTSQLV---PNSCSPGDPL 4 SSYV F +F P+ + + ++++K + IG++ + NSCSPGDPL Sbjct: 39 SSYVILFPAVALVFVPVFRAVHITSSYEYLEKRFSLVIRSIGSALFIIQTSNSCSPGDPL 98 Query: 3 V 1 V Sbjct: 99 V 99 Score = 27.5 bits (58), Expect = 8.3 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 3 LVDPPGCRNS 32 LVDPPGCRNS Sbjct: 15 LVDPPGCRNS 24 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 +V NSCSPGDPLV Sbjct: 6 IVSNSCSPGDPLV 18 >SB_12831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 46 QSARAEFLQPGGSTS 2 +SA+ EFLQPGGSTS Sbjct: 26 RSAKIEFLQPGGSTS 40 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 54 IGTSQLVPNSCSPGDPLV 1 I L NSCSPGDPLV Sbjct: 10 IDLKSLTSNSCSPGDPLV 27 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 +V NSCSPGDPLV Sbjct: 1 MVSNSCSPGDPLV 13 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 S L NSCSPGDPLV Sbjct: 9 SGLTSNSCSPGDPLV 23 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 S+ NSCSPGDPLV Sbjct: 78 SRFTSNSCSPGDPLV 92 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -2 Query: 91 IHQEG*TILVGTNWHQ--SARAEFLQPGGSTS 2 +HQ G LV N + EFLQPGGSTS Sbjct: 5 LHQNGVARLVALNSFNRTDSSIEFLQPGGSTS 36 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 49 HQSARAEFLQPGGSTS 2 H++ EFLQPGGSTS Sbjct: 53 HRTTNIEFLQPGGSTS 68 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 62 LLSNSCSPGDPLV 74 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 ++ ++ NSCSPGDPLV Sbjct: 10 SANILSNSCSPGDPLV 25 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 3 LVDPPGCRNSARAD 44 LVDPPGCRNS D Sbjct: 15 LVDPPGCRNSITKD 28 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 +S + NSCSPGDPLV Sbjct: 18 SSNISSNSCSPGDPLV 33 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 63 SEQIGTSQLVPNSCSPGDPLV 1 S +G + NSCSPGDPLV Sbjct: 13 SSIVGQRRRESNSCSPGDPLV 33 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 69 FLSEQIGTSQLVPNSCSPGDPLV 1 F I + + NSCSPGDPLV Sbjct: 4 FTDTLISANIFLSNSCSPGDPLV 26 >SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 42 QLVPNSCSPGDPLV 1 Q+ NSCSPGDPLV Sbjct: 3 QISSNSCSPGDPLV 16 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 54 IGTSQLVPNSCSPGDPLV 1 I ++ V NSCSPGDPLV Sbjct: 178 IDWTRRVSNSCSPGDPLV 195 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -3 Query: 57 QIGTSQLVPNSCSPGDPLV 1 ++ S + NSCSPGDPLV Sbjct: 35 KVSISFFLSNSCSPGDPLV 53 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 63 SEQIGTSQLVPNSCSPGDPLV 1 S +I + V NSCSPGDPLV Sbjct: 205 SPEICKTVNVSNSCSPGDPLV 225 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 66 LSEQIGTSQLVPNSCSPGDPLV 1 +S I ++ NSCSPGDPLV Sbjct: 9 ISANIILIKITSNSCSPGDPLV 30 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 +V NSCSPGDPLV Sbjct: 7 VVSNSCSPGDPLV 19 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 54 LLSNSCSPGDPLV 66 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 2 LLSNSCSPGDPLV 14 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 ++ V NSCSPGDPLV Sbjct: 7 SNDAVSNSCSPGDPLV 22 >SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) Length = 519 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 67 LVGTNWHQSARAEFLQPGGSTS 2 L +H+ EFLQPGGSTS Sbjct: 271 LSNEGFHEQVDIEFLQPGGSTS 292 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 3/30 (10%) Frame = -3 Query: 81 KARPFLSEQIG---TSQLVPNSCSPGDPLV 1 K R FL+++ + NSCSPGDPLV Sbjct: 29 KGREFLAKRARYCWPKDIASNSCSPGDPLV 58 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 +V NSCSPGDPLV Sbjct: 19 VVSNSCSPGDPLV 31 >SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 28.7 bits (61), Expect = 3.6 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +2 Query: 2 TSGSPGLQEFGTS*LVPICSDKNGLAFLMNCWRTTKLLKIKGKNINFCT 148 TSGSPGLQEF T P +D +A N + + + N+N T Sbjct: 14 TSGSPGLQEFDT----PTITDPREIANAFNEFFVSVAATYRFSNVNMRT 58 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 ++ NSCSPGDPLV Sbjct: 1 MISNSCSPGDPLV 13 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/24 (66%), Positives = 18/24 (75%), Gaps = 2/24 (8%) Frame = -3 Query: 66 LSEQIGT-SQLVP-NSCSPGDPLV 1 +S I T S+LV NSCSPGDPLV Sbjct: 9 ISANINTQSKLVASNSCSPGDPLV 32 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 ++ ++ NSCSPGDPLV Sbjct: 14 SAPVISNSCSPGDPLV 29 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L+ NSCSPGDPLV Sbjct: 1 LLSNSCSPGDPLV 13 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 42 QLVPNSCSPGDPLV 1 + V NSCSPGDPLV Sbjct: 6 EAVSNSCSPGDPLV 19 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 S + NSCSPGDPLV Sbjct: 60 SNFLSNSCSPGDPLV 74 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 ++ NSCSPGDPLV Sbjct: 4 IISNSCSPGDPLV 16 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = -3 Query: 99 LQQFIKKARPFLSEQIGTSQ----LVPNSCSPGDPLV 1 +Q I+ FL G++Q L NSCSPGDPLV Sbjct: 189 IQLSIEHIPRFLLRYYGSAQNGKHLRSNSCSPGDPLV 225 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 54 IGTSQLVPNSCSPGDPLV 1 + + V NSCSPGDPLV Sbjct: 187 VAVAVAVSNSCSPGDPLV 204 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 3.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 + V NSCSPGDPLV Sbjct: 14 ADFVSNSCSPGDPLV 28 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 ++ + NSCSPGDPLV Sbjct: 10 SANIASNSCSPGDPLV 25 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 30 VSNSCSPGDPLV 41 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 10 VSNSCSPGDPLV 21 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 15 VSNSCSPGDPLV 26 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 60 EQIGTSQLVPNSCSPGDPLV 1 E I Q + NSCSPGDPLV Sbjct: 56 ETILEVQPLSNSCSPGDPLV 75 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 2 VSNSCSPGDPLV 13 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 ++++ NSCSPGDPLV Sbjct: 10 TKVLSNSCSPGDPLV 24 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 15 LTSNSCSPGDPLV 27 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 40 VSNSCSPGDPLV 51 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 117 VSNSCSPGDPLV 128 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 34 VSNSCSPGDPLV 45 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 58 TNWHQSARAEFLQPGGSTS 2 T++ R EFLQPGGSTS Sbjct: 34 TSFGSDPRIEFLQPGGSTS 52 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 42 QLVPNSCSPGDPLV 1 Q NSCSPGDPLV Sbjct: 6 QATSNSCSPGDPLV 19 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 1066 VSNSCSPGDPLV 1077 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 78 LTSNSCSPGDPLV 90 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 3 LVDPPGCRNSARADWC 50 LVDPPGCRNS C Sbjct: 72 LVDPPGCRNSITVFHC 87 >SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) Length = 126 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +2 Query: 2 TSGSPGLQEFGTS*LVPICSDKN 70 TSGSPGLQEF T L+ D N Sbjct: 14 TSGSPGLQEFDTKGLLHTRMDGN 36 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 3 VSNSCSPGDPLV 14 >SB_7707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 Query: 91 IHQEG*TILVGTNWHQSARAEFLQPGGSTS 2 +H + +L G H EFLQPGGSTS Sbjct: 59 VHYDSELLLQGV--HDHVDIEFLQPGGSTS 86 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 32 VSNSCSPGDPLV 43 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.8 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = -3 Query: 123 LIFSNFVVLQQFIKKARPFLSEQIGTSQLVPNSCSPGDPLV 1 LI +N V+ +K + IG ++ NSCSPGDPLV Sbjct: 8 LISANIVLQIALVKDLPRYHLFGIG---VLSNSCSPGDPLV 45 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 5 LASNSCSPGDPLV 17 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 5 VSNSCSPGDPLV 16 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 3 VSNSCSPGDPLV 14 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 7 VSNSCSPGDPLV 18 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 54 IGTSQLVPNSCSPGDPLV 1 I + NSCSPGDPLV Sbjct: 14 ISCGRFASNSCSPGDPLV 31 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 75 RPFLSEQIGTSQLVPNSCSPGDPLV 1 RP +++ NSCSPGDPLV Sbjct: 1180 RPQVTKGNDLKPFASNSCSPGDPLV 1204 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 4 VSNSCSPGDPLV 15 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 T + + NSCSPGDPLV Sbjct: 19 TDRHLSNSCSPGDPLV 34 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 6 LASNSCSPGDPLV 18 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 4 VSNSCSPGDPLV 15 >SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 T + NSCSPGDPLV Sbjct: 4 TGEFGSNSCSPGDPLV 19 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 ++ + NSCSPGDPLV Sbjct: 10 SANITSNSCSPGDPLV 25 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 25 VSNSCSPGDPLV 36 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 15 VSNSCSPGDPLV 26 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 S + NSCSPGDPLV Sbjct: 29 SYRISNSCSPGDPLV 43 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 17 LASNSCSPGDPLV 29 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 42 QLVPNSCSPGDPLV 1 Q NSCSPGDPLV Sbjct: 11 QATSNSCSPGDPLV 24 >SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -3 Query: 54 IGTSQLVPNSCSPGDPLV 1 +GT Q NSCSPGDPLV Sbjct: 1 MGTVQ-ASNSCSPGDPLV 17 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 10 VSNSCSPGDPLV 21 >SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 T NSCSPGDPLV Sbjct: 48 TEDTTSNSCSPGDPLV 63 >SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +2 Query: 2 TSGSPGLQEFGTS*LVPICSDKN 70 TSGSPGLQEF S LV +N Sbjct: 14 TSGSPGLQEFDISNLVNYVGRRN 36 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 31 VSNSCSPGDPLV 42 >SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 175 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 75 RPFLSEQIGTSQLVPNSCSPGDPLV 1 RP + GT+ NSCSPGDPLV Sbjct: 40 RPSVEAAGGTAS--SNSCSPGDPLV 62 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 4 VSNSCSPGDPLV 15 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 42 QLVPNSCSPGDPLV 1 Q + NSCSPGDPLV Sbjct: 45 QSLSNSCSPGDPLV 58 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 4 VSNSCSPGDPLV 15 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 42 QLVPNSCSPGDPLV 1 Q NSCSPGDPLV Sbjct: 24 QAASNSCSPGDPLV 37 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 14 VSNSCSPGDPLV 25 >SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) Length = 351 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = -3 Query: 63 SEQIGTSQLVP--NSCSPGDPLV 1 +EQ +QL+ NSCSPGDPLV Sbjct: 216 AEQRNYTQLLESSNSCSPGDPLV 238 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 6 VSNSCSPGDPLV 17 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 ++ NSCSPGDPLV Sbjct: 5 VISNSCSPGDPLV 17 >SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 69 FLSEQIGTSQLVPNSCSPGDPLV 1 F I + + NSCSPGDPLV Sbjct: 4 FTDTLISANIISSNSCSPGDPLV 26 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 37 LTSNSCSPGDPLV 49 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 18 VSNSCSPGDPLV 29 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 78 ARPFLSEQIGTSQLVPNSCSPGDPLV 1 ++ +SE+ + NSCSPGDPLV Sbjct: 46 SKTIMSEKGTVTHRRSNSCSPGDPLV 71 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 20 LASNSCSPGDPLV 32 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 30 VSNSCSPGDPLV 41 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 66 LSEQIGTSQLVPNSCSPGDPLV 1 + E+ S NSCSPGDPLV Sbjct: 1 MKEKSFASCFASNSCSPGDPLV 22 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 32 VSNSCSPGDPLV 43 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 10 VSNSCSPGDPLV 21 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.3 bits (60), Expect = 4.8 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -3 Query: 123 LIFSNFVVLQQFIKKARPF--LSEQIGTSQLVPNSCSPGDPLV 1 LI +N Q I + R + S+ T+ NSCSPGDPLV Sbjct: 8 LISANIQNKLQTISRIRAYKNCSKLNKTAIKASNSCSPGDPLV 50 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 17 VSNSCSPGDPLV 28 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 14 VSNSCSPGDPLV 25 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 48 TSQLVPNSCSPGDPLV 1 T + NSCSPGDPLV Sbjct: 15 TERRASNSCSPGDPLV 30 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 34 VSNSCSPGDPLV 45 >SB_21152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 46 QSARAEFLQPGGSTS 2 +S R EFLQPGGSTS Sbjct: 9 KSLRIEFLQPGGSTS 23 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 88 LTSNSCSPGDPLV 100 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 11 LASNSCSPGDPLV 23 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -3 Query: 96 QQF-IKKARPFLSEQIGTSQLVPNSCSPGDPLV 1 +QF ++ P L + NSCSPGDPLV Sbjct: 69 RQFPVRPPSPILYCSAECVMTISNSCSPGDPLV 101 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 10 VSNSCSPGDPLV 21 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 23 VSNSCSPGDPLV 34 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 18 VSNSCSPGDPLV 29 >SB_13869| Best HMM Match : Antirestrict (HMM E-Value=4.5) Length = 149 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -2 Query: 40 ARAEFLQPGGSTS 2 AR EFLQPGGSTS Sbjct: 24 ARIEFLQPGGSTS 36 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 11 LASNSCSPGDPLV 23 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 3 LASNSCSPGDPLV 15 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 27 VSNSCSPGDPLV 38 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 9 VSNSCSPGDPLV 20 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 ++ NSCSPGDPLV Sbjct: 25 VISNSCSPGDPLV 37 >SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 51 GTSQLVPNSCSPGDPLV 1 G + NSCSPGDPLV Sbjct: 13 GPHEQTSNSCSPGDPLV 29 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 96 LASNSCSPGDPLV 108 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 L NSCSPGDPLV Sbjct: 4 LASNSCSPGDPLV 16 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 4.8 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 V NSCSPGDPLV Sbjct: 10 VSNSCSPGDPLV 21 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 + NSCSPGDPLV Sbjct: 5 ISNSCSPGDPLV 16 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 3 LVDPPGCRNSARADWC 50 LVDPPGCRNS C Sbjct: 15 LVDPPGCRNSISLVQC 30 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 S+ NSCSPGDPLV Sbjct: 20 SKRASNSCSPGDPLV 34 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/17 (70%), Positives = 14/17 (82%), Gaps = 1/17 (5%) Frame = -3 Query: 48 TSQLVP-NSCSPGDPLV 1 T + +P NSCSPGDPLV Sbjct: 15 TRKKIPSNSCSPGDPLV 31 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 66 LSEQIGTSQLVPNSCSPGDPLV 1 +S I NSCSPGDPLV Sbjct: 9 ISANIKGRHCASNSCSPGDPLV 30 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 3 LVDPPGCRNSAR 38 LVDPPGCRNS + Sbjct: 15 LVDPPGCRNSIK 26 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 3 LVDPPGCRNSAR 38 LVDPPGCRNS + Sbjct: 15 LVDPPGCRNSMK 26 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 S+ NSCSPGDPLV Sbjct: 50 SRSASNSCSPGDPLV 64 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 + NSCSPGDPLV Sbjct: 21 ISNSCSPGDPLV 32 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 +++ NSCSPGDPLV Sbjct: 20 TRVTSNSCSPGDPLV 34 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 + NSCSPGDPLV Sbjct: 59 ISNSCSPGDPLV 70 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 + NSCSPGDPLV Sbjct: 9 ISNSCSPGDPLV 20 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 + NSCSPGDPLV Sbjct: 10 ISNSCSPGDPLV 21 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 51 GTSQLVPNSCSPGDPLV 1 G + NSCSPGDPLV Sbjct: 3 GRRLFLSNSCSPGDPLV 19 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 + NSCSPGDPLV Sbjct: 3 ISNSCSPGDPLV 14 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 3 LVDPPGCRNSARADWCQF 56 LVDPPGCRNS + F Sbjct: 15 LVDPPGCRNSMSNPFAAF 32 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 39 LVPNSCSPGDPLV 1 ++ NSCSPGDPLV Sbjct: 55 ILSNSCSPGDPLV 67 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 + NSCSPGDPLV Sbjct: 13 ISNSCSPGDPLV 24 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 + NSCSPGDPLV Sbjct: 4 ISNSCSPGDPLV 15 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 + NSCSPGDPLV Sbjct: 52 ISNSCSPGDPLV 63 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 + NSCSPGDPLV Sbjct: 51 ISNSCSPGDPLV 62 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 + L NSCSPGDPLV Sbjct: 2 TSLSSNSCSPGDPLV 16 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 VPNSCSPGDPLV 1 + NSCSPGDPLV Sbjct: 16 ISNSCSPGDPLV 27 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 3 LVDPPGCRNSAR 38 LVDPPGCRNS + Sbjct: 15 LVDPPGCRNSIK 26 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 45 SQLVPNSCSPGDPLV 1 S NSCSPGDPLV Sbjct: 63 SSTTSNSCSPGDPLV 77 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 51 GTSQLVPNSCSPGDPLV 1 G + NSCSPGDPLV Sbjct: 27 GQKKNASNSCSPGDPLV 43 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 Query: 3 LVDPPGCRNSAR 38 LVDPPGCRNS + Sbjct: 15 LVDPPGCRNSMK 26 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,655,813 Number of Sequences: 59808 Number of extensions: 340903 Number of successful extensions: 2156 Number of sequences better than 10.0: 422 Number of HSP's better than 10.0 without gapping: 2114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2156 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -